KEGG   Nicotiana tabacum (common tobacco): 107799911Help
Entry
107799911         CDS       T04643                                 

Definition
(RefSeq) long chain acyl-CoA synthetase 6, peroxisomal
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00061  Fatty acid biosynthesis
nta00071  Fatty acid degradation
nta01100  Metabolic pathways
nta01212  Fatty acid metabolism
nta04146  Peroxisome
Module
nta_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    107799911
   00071 Fatty acid degradation
    107799911
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107799911
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nta01004]
    107799911
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nta04147]
    107799911
Enzymes [BR:nta01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     107799911
Lipid biosynthesis proteins [BR:nta01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   107799911
Exosome [BR:nta04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   107799911
  Exosomal proteins of breast cancer cells
   107799911
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 107799911
NCBI-ProteinID: XP_016478534
UniProt: A0A1S4APE9
Position
Un
AA seq 696 aa AA seqDB search
MESSAERRLKAIQNHLVPVIDDRSLSFIRSNPTAGEFVQGQGFSVVLPEKLQTGKWNVYR
SARSPLKLITRFPDHPEIATLHDNFEHAVQTYQDYKYLGTRIRVDGTIGDYKWMTYGEAG
TARTAIGSGLHYYGLQPGARVGLYFINRPEWLIVDHACSAYSYSSVPLYDTLGPDAVKYI
VNHADVQAIFCVPGTLNTLLTFLSEIPSVRLIVVVGGIDEHLPSLPSTTGMKLLSYTRLL
SQGRSSMQPFCPPKPEDIATICYTSGTTGTPKGVVLSHANLIASVAGMTLSIKFYPSDIY
ISYLPLAHIYERANQITSAYYGVAVGFYQGDNLKLMDDLAALRPTIFSSVPRLYNRIYAG
ITNAVQTSGVLKQRLFNAAYNSKKQAVMNGRKPSPMWDRLVFNKIKDKLGGRVRLMTSGA
SPLSPDVMEFLRVCFGCLVMEGYGMTETSCVISSMDDSDLLTGHVGSPNPACEIKLVDVP
EMSYTSEDQPHPRGEICVRGPIIFEGYYKDEVQTREVIDEDGWLHTGDIGLWLPGGRLKI
IDRKKNIFKLAQGEYIAPEKIENVYAKCKFVAQCFVYGDSFNSSLVAVVCVEPDVFKEWA
SSEGIKYESLGQLCNDPRAKAAVLAEMDAVGREAQLRGFEFAKAVTLVIEPFTIENGLLT
PTFKVKRPQAKAYFAKAISDMYNELSTSDPAAQKSL
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atggaatcatcggcagagcgacgtctgaaagctattcaaaaccatcttgttccggtcatc
gatgaccggtcactctcattcatccggtcaaacccaaccgccggcgaatttgttcaaggt
cagggtttcagcgtagttcttcctgaaaaattgcagacaggaaaatggaatgtgtacaga
tctgcacgatctcctctgaagcttattactagattccctgatcatcctgaaattgctaca
ctacatgataactttgaacatgcagttcaaacctatcaggattacaaatacttgggtaca
cgtattcgggtagatggaactattggagactacaaatggatgacatatggagaggcaggg
actgctcggactgcaattggttctggacttcactattatggattgcaaccgggtgctcgc
gtgggactttatttcataaataggcctgagtggctgatcgtagaccatgcctgctcagcg
tattcatattcttcagtcccactatatgacactcttggtcctgatgctgttaaatatatt
gtcaatcatgctgatgtacaggccattttttgtgtgcctggtaccttgaacacgttgttg
acctttttatcggagattccttctgtacgtttgattgtggtagtgggtgggatagatgaa
catctgccatctcttccatctacaacgggaatgaagctcttatcatatacaaggctgctg
agtcagggccgcagcagtatgcaacccttttgccctcccaagcctgaagacattgctacc
atatgctatacaagtggtactacgggtacaccaaagggtgtcgtactatcccatgcgaac
ctgatagcaagtgttgcgggcatgaccctttccatcaagttttatccttctgacatatac
atatcctatcttcctctcgcgcacatctatgaacgtgccaaccaaattacatcggcatat
tatggtgttgctgttggcttctaccaaggggacaatctgaaattgatggatgatttggcg
gcacttagacctacaatatttagcagtgttcctcgtctgtacaacaggatatatgctggg
atcacaaatgctgtacaaacttctggcgttctgaagcagagactgttcaatgctgcctac
aactctaagaagcaagctgtcatgaatggtagaaaaccatcaccaatgtgggatagattg
gtattcaacaaaataaaggacaaactgggggggcgagttcgtcttatgacctcaggtgct
tcaccattgtcgccagacgtgatggagttcttgagagtatgttttggctgtctagtaatg
gaagggtatggcatgactgagacttcatgtgtcataagctcaatggacgatagtgatctc
ttaactggtcatgttggttcaccaaatcctgcgtgtgagataaaactcgtggatgttccg
gaaatgagttacacatcagaagatcagcctcatcctcgtggagagatttgtgttagaggt
cctattatttttgaaggctattacaaagatgaagtgcagacgagggaggtaattgatgaa
gacgggtggctgcatactggtgatattggattatggttacctggaggccgcttgaagatt
attgataggaagaagaatatcttcaagttggcacaaggtgaatacatagctcctgagaaa
attgagaatgtttatgccaaatgcaaatttgttgcacagtgctttgtctatggtgatagc
tttaattcctctttagtagcagtggtttgtgtagagccagatgtctttaaggaatgggca
tcatctgagggaatcaagtatgaaagtttgggacaactgtgtaatgatccaagagcgaag
gctgcagttcttgctgagatggatgctgtcggaagggaagcgcagttgagaggtttcgaa
tttgcaaaagctgtaacattggttatcgagcctttcacgatcgaaaatggtctgctcact
cccacattcaaggtgaagagaccgcaggcaaaggcttattttgccaaagcaatatctgat
atgtataatgagctttctacatcagatccagcagcccagaaatcgctatga

DBGET integrated database retrieval system