KEGG   Nicotiana tabacum (common tobacco): 107800308Help
Entry
107800308         CDS       T04643                                 

Gene name
EF-Tu, TUFA
Definition
(RefSeq) elongation factor TuA, chloroplastic
  KO
K02358  elongation factor Tu
Organism
nta  Nicotiana tabacum (common tobacco)
Brite
KEGG Orthology (KO) [BR:nta00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:nta03012]
    107800308 (EF-Tu)
   03029 Mitochondrial biogenesis [BR:nta03029]
    107800308 (EF-Tu)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nta04147]
    107800308 (EF-Tu)
Translation factors [BR:nta03012]
 Eukaryotic Type
  Elongation factors
   107800308 (EF-Tu)
 Prokaryotic Type
   107800308 (EF-Tu)
Mitochondrial biogenesis [BR:nta03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    107800308 (EF-Tu)
Exosome [BR:nta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107800308 (EF-Tu)
  Exosomal proteins of breast cancer cells
   107800308 (EF-Tu)
  Exosomal proteins of colorectal cancer cells
   107800308 (EF-Tu)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 DAP_epimerase cobW
Motif
Other DBs
NCBI-GeneID: 107800308
NCBI-ProteinID: XP_016478946
UniProt: P68158 A0A1S4AQT9
Position
Un
AA seq 478 aa AA seqDB search
MASISAATATSSTKLVSSNSTNPLLPSSTKPSKLILSSSFTPNCSTLFLHSPATPSSTAT
HRHRRFTVRAARGKFERKKPHVNIGTIGHVDHGKTTLTAALTMALASMGNSAPKKYDEID
AAPEERARGITINTATVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSGADG
PMPQTKEHILLAKQVGVPNMVVFLNKQDQVDDEELLQLVELEVRELLSSYEFPGDDIPII
SGSALLALEALMANPSIKRGENQWVDKIYELMDAVDSYIPIPVRQTELPFLMAIEDVFSI
TGRGTVATGRVERGTVRIGDTVDIVGLKDTRSTTVTGVEMFQKILDEAMAGDNVGLLLRG
IQKIDIQRGMVLAKPGTITPHTKFEAIVYVLKKEEGGRHSPFFSGYRPQFYMRTTDVTGK
VTSITTDKGEESKMVMPGDRVNLVVELIMPVACEQGMRFAIREGGKTVGAGVIQKIIE
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaatttcagcagccaccgccacctcctccactaagcttgtatcatccaactcc
accaatcctcttcttccttcctccactaaaccctctaagcttatcctatcctcttccttt
acccctaattgttccacccttttcctccactcacccgccaccccttcttctactgccacc
catcgccaccgccggtttactgtccgcgctgcccgtggcaaattcgagcggaaaaaaccc
catgtcaacatcggtactattggccatgttgaccacggaaagactactctcaccgctgct
ttaaccatggctcttgcttctatgggaaactccgcccctaagaaatacgacgaaattgat
gccgccccagaagagcgtgctcgtggtattactattaacactgctactgttgagtacgag
actgagaaccgtcactacgcccacgtggattgccctggtcacgctgattatgtcaagaat
atgattaccggtgctgcccaaatggacggcgctattcttgtttgttcaggtgctgatggt
cccatgccacagactaaggaacacattttgcttgctaagcaagtaggtgtccccaacatg
gttgtgttcttgaacaaacaagatcaggttgatgatgaggagctgcttcagcttgttgag
ttggaggtaagagagttattgtcaagttatgagtttcctggtgatgatattcctattatt
tctggctctgctcttttggctttagaggctttgatggctaatcctagtattaagagaggt
gaaaatcaatgggttgataagatatatgagttgatggacgctgttgatagttatattcct
attccagttaggcaaactgaattgcctttcttgatggctattgaagatgtgttttccatt
actggtagaggtactgtggcgacggggagggtagagagagggactgttaggattggagac
actgttgatattgtaggtttgaaggacactaggagtactaccgtgacgggtgttgagatg
tttcaaaagattttggatgaagcaatggctggagacaatgtggggttgttgttgagaggt
attcaaaagattgatattcagagaggaatggtgttggcaaaacccggaacaattacccct
cacaccaagtttgaagctattgtgtatgtgttgaagaaggaggagggtggtaggcattcc
cccttcttttcagggtacaggcctcagttttacatgaggactactgatgtgaccggaaag
gttacttccattacgactgataaaggagaggaatctaagatggtcatgcctggtgatcgt
gtgaacttggtggttgagctcattatgccggtggcttgtgagcaagggatgagatttgcc
atcagggaaggaggaaagactgttggagctggtgtcattcagaaaattatcgagtga

DBGET integrated database retrieval system