KEGG   Nicotiana tabacum (common tobacco): 107802389Help
Entry
107802389         CDS       T04643                                 

Definition
(RefSeq) protein S-acyltransferase 10-like
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
nta  Nicotiana tabacum (common tobacco)
Brite
KEGG Orthology (KO) [BR:nta00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107802389
Enzymes [BR:nta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     107802389
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 107802389
NCBI-ProteinID: XP_016481358
UniProt: A0A1S4AXX9
Position
Un
AA seq 345 aa AA seqDB search
MVALCGGISRDTWDGLSFFPCLSDPARRSTFCLKVALVMLHLIYAGVLFEFDKDLIQKTK
QDPWYTTAYLLLLAATLAQYFITSGSSPGYVLDAMRAANETDASHNRTSITSNQPASSKN
GSVVITIDRNQLEKNLLGSGTTTSWAKLVMDMYPPGTSVRSVTCTYCNIMQPPRAKHCHD
CDKCVLQFDHHCVWLGTCVGQGNHCRFWWYICSETALSLWTGTLYIQYLKSHVSKLWWSY
AIVILLLAALSICLFFLLLLLLFHSYLILTNQTTYELVRRRRIPYLRNIPERVFPFSKGA
CRNSYEFCCARSSMYRMEPLPTAQELQEKSRPYTCLDFFACRCCC
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggtagcattatgtggcggcatatcccgcgacacatgggatggtctctccttcttcccc
tgcctctccgaccccgctcggagatcgacattttgcttgaaagtagcactggtgatgctg
cacctgatctatgccggtgttctatttgaatttgacaaagacttgattcagaaaaccaaa
caagacccctggtacacgacagcgtatttgctgttgcttgctgctacactggctcagtac
ttcatcacctctggttcttctcctggctatgttcttgatgcaatgagggctgccaatgag
acagatgcatcacataataggacatcaataacctcaaaccagcctgcttcaagcaaaaat
ggcagtgtagttattacgatcgacagaaaccagttagaaaagaatcttcttgggagtggt
acaacaacatcttgggcaaagctagtgatggatatgtatcctccaggaacatctgttaga
agtgtgacgtgcacctactgtaatattatgcagcctccacgagctaaacattgtcatgat
tgtgacaaatgcgttctccagtttgatcatcactgtgtttggcttggcacatgcgtagga
cagggtaaccattgccggttttggtggtacatttgctcagaaacagccttgtccctttgg
actggcactttatatattcaatacttgaagtctcacgtatcaaagctatggtggtcatat
gcaattgtgatattgctgttagctgctttatctatttgcctcttctttctcctcctcctc
ctcctatttcatagctatcttattttgacaaatcagaccacctatgagctcgttagacga
cggcgcatcccctatttgaggaacataccggaaagagtttttccatttagcaaaggagca
tgcagaaattcatacgagttctgctgtgctcggagcagcatgtacaggatggaaccactg
ccaacagcacaagaacttcaagagaagtcaagaccctatacatgcttggatttttttgct
tgtcggtgttgctgttga

DBGET integrated database retrieval system