KEGG   Nicotiana tabacum (common tobacco): 107804151Help
Entry
107804151         CDS       T04643                                 

Definition
(RefSeq) heat shock 70 kDa protein-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta03040  Spliceosome
nta04141  Protein processing in endoplasmic reticulum
nta04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:nta00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107804151
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107804151
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107804151
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nta01009]
    107804151
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:nta03041]
    107804151
   03009 Ribosome biogenesis [BR:nta03009]
    107804151
   03110 Chaperones and folding catalysts [BR:nta03110]
    107804151
   04131 Membrane trafficking [BR:nta04131]
    107804151
   03051 Proteasome [BR:nta03051]
    107804151
   03029 Mitochondrial biogenesis [BR:nta03029]
    107804151
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nta04147]
    107804151
Protein phosphatases and associated proteins [BR:nta01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     107804151
Spliceosome [BR:nta03041]
 Complex B
  Other components
   Prp19 complex
    107804151
 Complex C
   Prp19-CDC5 complex
    107804151
Ribosome biogenesis [BR:nta03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    107804151
Chaperones and folding catalysts [BR:nta03110]
 Heat shock proteins
  HSP70 / DNAK
   107804151
Membrane trafficking [BR:nta04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    107804151
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    107804151
Proteasome [BR:nta03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    107804151
Mitochondrial biogenesis [BR:nta03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    107804151
Exosome [BR:nta04147]
 Exosomal proteins
  Proteins found in most exosomes
   107804151
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A CPSase_L_D2 DUF4795
Motif
Other DBs
NCBI-GeneID: 107804151
NCBI-ProteinID: XP_016483467
UniProt: A0A1S4B3H0
Position
Un
AA seq 659 aa AA seqDB search
MATKEGKAIGIDLGTTYSCVGVWLNDRVEIIPNDQGNRTTPSYVAFTDTERLIGDAAKNQ
VAMNPHNTVFDAKRLIGRRFTDPSVQSDMKLWPFKVLSGPGEKPMIEVSYKGEKKQFSAE
EISSMVLNKMKETAENFLGFQVKNSVVTVPAYFNDSQRQATKDAGAISGMNILRIINEPT
AAAIAYGLDKKSSRIGEQHVLVFDLGGGTFDVSVLTIEEGIFEVKATAGDTHLGGEDFDN
RLVNHFVTEFKRKNKKDLSGNARALRRLRTGCERAKRTLSSTTQTTIEVDSLFEGIDFYA
TITRARFEELCMDLFMKCMEPVEKCLRDGKIDKSQIHEVVLVGGSTRIPKVQQLLQDFFN
GKELCKSINPDEAVAYGAAVQAAILTGEGDEKVQDLLLLDVTPLSLGLETAGGVMTVLIP
RNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQIN
VTFDIDANGILNVTAEDKTAGVKNKITITNDKGRLSKDEIDRMVRDAERYKAEDEEVKKK
VEAKNGLENYAYNMRNTIKDEKIASKLSSEDKEKIEKGVQETIEWLDKNQLAEVDELEDK
LKELERICNPIIARMYQGGGGGGGAGGGVSMDDDQMPGGGTRGGASGTTGTEPKIEEVD
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccaaagaaggaaaagcaataggaatagacctcggcacaacatatagttgtgtt
ggtgtatggttaaatgacagagttgaaatcataccaaacgatcaaggcaacagaacaaca
ccatcttatgttgcttttactgatactgaacgtttaattggtgacgcagccaagaatcaa
gtagctatgaatccacacaacacagtttttgatgctaaacgtttaatcggtcgtagattt
actgacccttctgttcaaagtgatatgaaattgtggcctttcaaagttttatcaggacca
ggtgaaaaaccaatgatagaagtaagttacaaaggtgagaaaaaacagttttcagctgag
gagatttcatcaatggtattgaataaaatgaaagaaacagctgagaattttttagggttt
caagtgaaaaattctgtagttactgtacctgcttattttaatgattctcaaagacaagca
actaaagatgctggagctataagtggaatgaatattttgagaattattaatgaaccaact
gctgctgctatagcttatggtttagataaaaaaagttcaagaattggtgaacaacatgtt
cttgtttttgatttaggtggtggaacttttgatgtatcagttttaactattgaagaagga
atttttgaggttaaagctacagctggtgatacacatttaggtggtgaagattttgataat
aggttagtaaatcattttgtaactgaatttaagagaaaaaataaaaaggatttaagtgga
aatgctagagctttaagaagattaagaactggttgtgaaagggcaaaaaggacattatca
tcaacaactcaaactactatagaagttgattctttatttgaaggaattgatttttatgca
acaataacaagagctaggtttgaggagttgtgcatggatttgttcatgaaatgtatggaa
ccagttgagaaatgtttaagagatggtaaaattgataaatctcaaatacatgaagttgtt
ttagttggcggatcaacaagaataccaaaagtacaacaacttttacaagatttttttaat
ggtaaagaattatgtaaaagtataaatccagatgaagctgttgcatatggtgcagcagtt
caagctgcaatcttgactggtgaaggtgatgaaaaagttcaagatttgcttttacttgat
gttacaccattaagtcttggacttgaaacagcaggtggagtaatgactgttttaatacca
agaaatacaacaattccaactaaaaaagaacagattttttcaacttattcagataatcaa
cctggtgtactaatccaagtatacgaaggagaaagagcaagaacaagagacaacaatctt
ttaggaaaatttgaactttctggtattccaccagcaccaagaggggttcctcagatcaat
gttacattcgatatcgacgcgaatgggatcttaaatgtgactgctgaggataaaactgct
ggtgtaaagaacaagattacaatcacaaatgataaaggaagattgagtaaagatgagatt
gatagaatggtgagagatgctgagaggtataaagctgaagatgaagaagtgaaaaagaaa
gttgaagctaagaatggacttgagaattatgcttataatatgaggaatacaattaaagat
gagaaaattgcaagtaaattgagttctgaggataaagagaagattgagaaaggtgttcaa
gaaactatagaatggttggataagaatcaattagctgaagttgatgaacttgaagataag
ttgaaggaacttgaaaggatttgtaatcctataattgcaagaatgtatcaaggtggcggc
ggcggtggtggtgcaggtggtggtgtttctatggatgatgatcaaatgccgggtggtggt
acaagaggtggagctagtggtactactggtactgaacctaagattgaagaagttgattag

DBGET integrated database retrieval system