KEGG   Nicotiana tabacum (common tobacco): 107806987Help
Entry
107806987         CDS       T04643                                 

Gene name
MPK12
Definition
(RefSeq) mitogen-activated protein kinase 9-like
  KO
K20538  mitogen-activated protein kinase 8 [EC:2.7.11.24]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta04016  MAPK signaling pathway - plant
Brite
KEGG Orthology (KO) [BR:nta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    107806987 (MPK12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nta01001]
    107806987 (MPK12)
Enzymes [BR:nta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107806987 (MPK12)
Protein kinases [BR:nta01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107806987 (MPK12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 107806987
NCBI-ProteinID: NP_001312726
UniProt: I7FJJ2
Position
Un
AA seq 594 aa AA seqDB search
MGGGNTFVDGFRRWFQRRSTTTTTTTIVHSNADSILNSNNFEKKPIHFSEEELTIIEDFD
ISGLKLISVPKRVDFPFTMDPHKKNTQEAEFFTEYGEASRYQIQEVIGKGSYGVVASAVD
TKTGERVAIKKIHDVFEHVSDATRILREIKLLRLLRHPDIVEIKHIMLPPSRREFKDIYV
VFELMESDLHQVIKANDDLTPEHYQFFLYQLLRGLKYIHTANVFHRDLKPKNILANADCK
LKICDFGLARVSFNDTPSAIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEM
LTGKPLFPGKNVVHQLDLMTDLLGTPPPETVAKIRNEKARRYLSNMRKKPPVPFSQKFPH
VDPFALRLLECLLAFDPKDRPSAEEALGDPYFRGLSNVDREPSTHPISKLEFEFERRKLA
KEDVRELIYREILEYHPQMLQEYLRGGDQTSGFMYPSGVDRFKRQFAHLEEHYGKGERST
PLQRQHASLPRERVPAPKDETSSQNDDFEKRTSASVASTLQSPPGQSEGSENSDANMQNG
PNKANYSARSLLKSASISASKCIEVKRSNTEEEPIEEQSEDVDGLAQKVAALHA
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggggggtggtaatacattcgtggatggatttcgtcgctggtttcaacgtcgttctact
actacaacaactactactattgttcatagcaatgcagattcgatcttgaatagtaataat
tttgaaaaaaagcccattcatttttcagaagaagaacttaccattatcgaagactttgac
atttcgggtcttaaacttatctcagtccccaaacgggtcgatttcccttttaccatggat
cctcacaaaaagaatacacaggaggcggaattcttcacagaatatggagaagcaagcaga
taccaaattcaggaagttatcggcaagggtagctatggagttgtggcatccgctgttgat
accaaaactggagaaagagttgcaatcaagaagattcatgacgtgtttgagcatgtctct
gatgccacacgaattttaagagaaatcaagcttcttcggctactacgacatcctgatatt
gtagaaataaagcacatcatgttacccccatctcggcgagagtttaaagatatttacgtt
gtttttgaattgatggagtctgatcttcaccaggtaattaaggccaatgatgatcttaca
cctgagcattatcagttttttctgtaccagcttctgcgaggattaaaatatattcataca
gcaaacgttttccatcgagatttaaagccgaagaatatccttgctaacgctgactgtaaa
ttgaagatttgtgactttggccttgctcgtgtatcatttaatgacacgccatcagctatt
ttctggactgactacgttgcaactcgatggtatcgtgctcctgagctatgtggctccttt
ttctccaagtacactcctgctattgatatttggagcatcggatgcatatttgcagaaatg
ctcactggaaaaccattatttcctggaaagaatgtggtgcatcaattagaccttatgact
gatttactaggaacacctcctcctgaaaccgttgcaaagattagaaatgagaaggccaga
agatacctcagtaacatgcggaaaaaaccacctgttccattttcacaaaaatttccacac
gtggatcctttcgctctgcgcctacttgaatgcctgcttgcatttgaccctaaagatcga
ccatctgcggaagaggcactgggtgatccttatttccgtggtttgtcaaatgtggaccgt
gaaccatccactcacccaatatcaaagcttgagtttgaatttgagaggagaaagttggca
aaagaagatgttagagagctcatttatcgggagattttagaatatcatcctcagatgctt
caggagtatcttcgtggcggagatcagactagtggatttatgtacccaagtggtgtcgat
cggttcaagcgacagtttgcacatcttgaggagcattatggtaaaggtgaacgaagcact
ccacttcagaggcagcatgcatccttgcctagagaacgggttcctgcaccaaaagatgaa
acttcttcccaaaacgatgattttgaaaagcgaacttcagcatctgttgcttcaactctc
cagagcccaccagggcaatctgagggatcagagaactcagatgctaatatgcaaaatgga
ccaaacaaggcaaactatagcgctcgtagtttgctgaagagtgctagtatcagtgcttca
aagtgtatagaagttaaaagaagcaatacagaggaagagccaattgaagaacaaagcgag
gatgttgatggtttagctcaaaaagttgctgctctccatgcctaa

DBGET integrated database retrieval system