KEGG   Nicotiana tabacum (common tobacco): 107807993Help
Entry
107807993         CDS       T04643                                 

Definition
(RefSeq) acid beta-fructofuranosidase-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00052  Galactose metabolism
nta00500  Starch and sucrose metabolism
nta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107807993
   00500 Starch and sucrose metabolism
    107807993
Enzymes [BR:nta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     107807993
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 107807993
NCBI-ProteinID: XP_016487958
UniProt: A0A1S4BGG2
Position
Un
AA seq 652 aa AA seqDB search
MQKMAETNNSVPYTQLPAEDNNTSSNSPAKCRRRPKRVSFIVLTGLVAALLLFVAVKYGN
NEAEDVNPGPVPPQETVCNMLGSNLMPLTTMRTVARGVAEGVSAKSRGRFLGLRPFPWTK
QMLAWQRTSFHFQPKKNWMNDPNGPLFYKGWYHLFYQYNPEAAVWGNIVWGHAVSRDLIH
WQHLPVAMVADQWYDINGVWTGSATILPDGKLVMLYTGSTNESVQVQNLAYPADPSDPLL
RKWVKYEGNPVLVPPPGIATKDFRDPTTAWTTPQGKWRITIGSKVNKTGISLVYDTIDFK
KFELLDGVLHGVPGTGMWECVDFYPVSKVVENGLDTSDNGPAVKHVLKSSLDDDRNDYYA
LGTYDAVAGKWIPDNPTIDVGIGLRYDYGNFYASKTFYDQEKKRRVLWAWITEGDSEAAD
ICKGWASLQPIPRTIKYDKKTGSNIITWPVAEVENLRLNSKEFDKVEVKPGSVFPLEVGT
ATQLDIMAEFEIDPKVLERLEGNNATYECRSSGGSAERGALGPFGLLVLTDKGLSEQTPI
YFYIAKDAAGNFTTFFCNDLTRSSEATDVRKLIYGSTVPVLQGEKLSLRTLVDHSIVESF
AQSGRTAITSRVYPTKAIYEDAKLYLFNNATDVSITASLKIWQMNSANIQSS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagatggcggaaacaaacaatagcgttccttacacccaattaccggcggaggac
aataacacctccagtaattctccggccaaatgccggcgacgacccaaaagagtgtcgttc
atagtattaacagggctggtggcagctttgttactttttgtggcagtgaaatatgggaat
aacgaggcggaggatgtaaatccagggccagtaccaccacaagaaaccgtgtgtaacatg
cttggttctaatctaatgccgctgaccaccatgaggacggtggcgcgtggggtggcagaa
ggtgtctccgccaagtcacgcggtcgtttcttgggattacggccgtttccatggaccaaa
caaatgttggcttggcaaagaacatccttccactttcaacctaagaagaattggatgaat
gatcctaatggtccattattctacaaaggatggtaccatttgttctatcaatacaatcca
gaggctgcagtatggggaaatattgtatggggccatgcagtttcaagagacttaattcac
tggcaacaccttccagttgctatggttgcggatcaatggtacgacattaacggtgtatgg
accggatccgcaaccattttacccgatggtaaactcgtcatgttatataccgggtcaacc
aacgagtcagtacaggttcaaaatctagcgtacccggctgacccatcggatcctctccta
agaaaatgggtcaaatatgagggcaacccggtacttgtaccaccacccggaattgctact
aaagattttcgtgaccccaccactgcatggaccacaccacaaggcaaatggaggattact
attggttcaaaggttaataaaactggaatttcattggtctatgacactattgattttaag
aaatttgagttgttggatggggtgctccatggtgtaccgggtacgggtatgtgggaatgt
gtggacttttacccggtttcgaaagttgttgaaaatgggcttgacacatcagataatggg
cctgcagtaaaacatgtgttaaagtccagtctagatgatgatagaaatgattattatgca
cttggaacttatgatgcagtggctggtaaatggattcctgataatcccacaattgatgtt
ggtattggattaagatatgattatggaaatttttacgcatcaaaaacattttatgaccaa
gaaaaaaagagaagagtcctttgggcttggattactgaaggtgatagtgaagctgctgat
atttgcaaaggttgggcatcacttcagcctattccaaggactataaaatatgacaagaag
acaggaagcaacataattacttggccagtggcggaggttgagaatttgagattaaacagt
aaggaattcgacaaggtggaggtaaaaccagggtcagtttttccactagaagttggcact
gccactcagttggacataatggctgagtttgaaatagaccctaaggtcttggagagatta
gaaggaaataatgctacatatgagtgcagaagcagtgggggatctgctgaacgtggtgcc
ttaggaccatttggtttattggttttaacagataagggcttgtccgagcaaactccaatt
tacttctacattgcaaaagacgctgctggaaatttcaccacattcttctgcaatgatctt
accaggtcatctgaagcaacagatgttcgcaaactaatctacggaagcacagttccagtc
ctccaaggagagaagctttctctaagaacactggtggatcattcaatagtagaaagtttt
gcacaaagtggaaggacagcaataacgtcaagggtatatccaacaaaggcaatatatgaa
gatgctaagctctacttatttaacaatgctacagatgttagcattactgcctcactcaag
atttggcaaatgaattctgcaaatatacaatctagttaa

DBGET integrated database retrieval system