KEGG   Nicotiana tabacum (common tobacco): 107808382Help
Entry
107808382         CDS       T04643                                 

Definition
(RefSeq) lactosylceramide 4-alpha-galactosyltransferase-like
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00601  Glycosphingolipid biosynthesis - lacto and neolacto series
nta00603  Glycosphingolipid biosynthesis - globo and isoglobo series
nta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    107808382
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    107808382
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:nta01003]
    107808382
Enzymes [BR:nta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     107808382
Glycosyltransferases [BR:nta01003]
 Glycan extension
  P blood group
   107808382
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug Caps_synth DUF3029
Motif
Other DBs
NCBI-GeneID: 107808382
NCBI-ProteinID: XP_016488384
UniProt: A0A1S4BHN4
Position
Un
AA seq 456 aa AA seqDB search
MDSVINNTKRTINSSLSQFFHHFCNFQLTKRSLYAIVSCFLLFLIAYNSSTVFYIQVPVP
ANSSPEISNFLTENVARKSRKLVSLSASTKLSSSVIYAVKEETPLQKTNTQLTISRKNQN
FVSFTYNSVAYHPRRRRKKKSLVKVLGSGARINEFSMRMKIFFGAKSSNTSCKYRFFMTW
ISSIESFGEREQFAVESLFKTHPNGCLVVMSTSMDSPKGMQVLKPFFEKGLRVTAISPDY
YYLFKNTLARAWVDSLMKGNIDPGEVSIGQNLSNLLRLGLLYKFGGIYLDTDVILLRSFG
KLRNVIGAQTIDVETKNWSRLNNAVMIFDKGHPLLYKFIEEFALTFDGNKWGHNGPYLVS
RVVSRVSGRDGYNFTVLPPMAFYPVDWSRIGSLFLGPRNETHSKWLLSKLRQIQSQSLAV
HLWNKQSRGLKVEEGSIIQHIMSDCCVFCNSYSAKL
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggacagtgtaattaataatacaaagagaactatcaattctagtttgtctcagtttttt
caccatttttgtaatttccagttgactaaaaggtccttatatgcaattgtttcttgcttt
ctgctttttctcatagcttacaacagttccactgtgttctacattcaagttccagttccg
gccaactcctcgccggagatttctaactttttaactgaaaatgtcgccagaaaatcaaga
aagttggtttctttatctgcttcaactaaactctcatcttctgtgatatatgcagtaaaa
gaggaaaccccacttcaaaaaacaaacacccagttgacaatttctcgcaaaaatcaaaac
tttgtgagttttacatataattcagtggcttatcatcctagaagaaggcgaaaaaagaag
tctttggtgaaagttcttggttcgggggcaagaattaatgagttctcaatgagaatgaaa
attttttttggagctaaatcatccaatacttcctgtaagtataggttttttatgacttgg
atttcttcaattgaatcttttggtgaaagggaacagtttgctgttgagagtttattcaaa
acacatccaaatggctgtttggtagttatgtccacttcaatggattcaccaaagggaatg
caagttttaaagcctttctttgagaaaggattaagggtaactgcaatctcacctgattat
tattatttgtttaaaaatacattggctcgagcctgggttgatagcttaatgaagggtaat
atagatccaggggaagtttctataggtcagaacctctcaaatttgcttagacttggttta
ttgtacaagtttggtgggatttatttagatacagatgttatactgttgagaagttttggg
aagctaagaaatgtaattggggctcaaactattgatgttgaaacaaaaaattggagcagg
ttaaataatgctgtaatgatttttgataaggggcatcctttgttgtacaagttcattgag
gaatttgcacttacatttgatgggaataaatggggacataatggtccttacttggtttca
agggttgtgtcaagggtaagtggaagggatggatacaatttcacagttttgcctccaatg
gctttttatccagttgattggagtaggattggtagtctctttcttgggccaaggaacgag
actcactcaaaatggttgctctctaaactccggcagattcagagccaaagtttggctgtg
catctttggaacaaacagagtagagggcttaaggttgaagaaggaagcataatccaacat
ataatgtcagattgttgtgttttctgcaattcttactccgcaaagttgtaa

DBGET integrated database retrieval system