KEGG   Nicotiana tabacum (common tobacco): 107808557Help
Entry
107808557         CDS       T04643                                 

Gene name
Ntbfruc1
Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 1-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00052  Galactose metabolism
nta00500  Starch and sucrose metabolism
nta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107808557 (Ntbfruc1)
   00500 Starch and sucrose metabolism
    107808557 (Ntbfruc1)
Enzymes [BR:nta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     107808557 (Ntbfruc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 107808557
NCBI-ProteinID: NP_001312753
UniProt: Q43799
Position
Un
AA seq 580 aa AA seqDB search
MEFLRNSSLWSLQILLLGVFVFVSNNGGVDASHKVYMHLQSTSSNVKNVHRTGYHFQPPK
NWINDPNGPMYYNGVYHLFYQYNPKGAVWGNIVWAHSVSTDLINWIPLEPAIYPSKIFDK
FGTWSGSATILPGNKPIILYTGIIDANRTQVQNYAIPANLSDPYLRKWIKPDNNPLIVAD
MSINKTQFRDPTTAWMGRDGHWRILVGSVKNHRGKVILYRSKDFMKWTKAKHPLHTATNT
GNWECPDFFPVSLKHTNGLDTSYRGEYTKHVLKVSLDVTRFEYYTVGTYDTRKDRYIPDN
TSVDGWKGLRLDYGNYYASKSFFDPSKNRRIMLGWANESDTVDDDVRKGWAGVHPIPRKL
WLDPSGKQLVQWPVEELETLRKKKVQLSNHKLYKGEMIEVKGITVAQADVEVTFSFASLD
KAEPFDPSWADLYAQDVCAIKGSTVQGGRGPFGLITLASKNLEEYTLVFFRVFKAQDKYK
VLMCSDASRSTLKNETTMYKPSFGGYVDVDLADKKLSLRSLIDNSVVESFGAGGKTCITS
RVYPTLAIFDKAHLFAFNNGTEAITIETLNAWSMADAKLH
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggagtttttaagaaactcttctctttggtctttgcaaattcttttgttgggtgtcttt
gtttttgtttcaaacaatggtggtgtcgatgcttctcacaaagtctatatgcatttgcaa
tctactagctctaatgtcaagaatgttcacagaactggttaccattttcaaccacctaaa
aactggattaacgatccaaatggcccaatgtattacaatggagtctaccatctattctac
caatacaacccaaaaggagcagtatggggcaacattgtttgggcccattcagtctcaaca
gatttgattaattggataccacttgagcctgctatttacccttccaaaatatttgacaag
tttggaacatggtcaggttcagctacaattttgccaggcaacaagcccattatcctctac
actggaattatagatgctaacaggacacaagtccaaaactacgcgatcccggctaacttg
tccgatccatatctccgtaaatggatcaagcccgataacaatccgttaatcgttgctgac
atgagcatcaacaagactcaatttcgcgacccaacgacagcttggatgggccgagatggt
cattggagaatcttggttgggagtgtgaagaatcatagaggaaaggtaatattgtataga
agtaaggacttcatgaaatggactaaagccaaacatccacttcatacagctaccaatact
ggaaattgggaatgtcctgattttttcccagtgtcactaaagcatacaaatggtttggac
acctcatatcgtggcgaatacactaagcatgttcttaaggttagccttgatgttacgagg
tttgagtactacacagtcggtacctatgacactagaaaagataggtacattccggataac
acttctgttgatggttggaagggattgagacttgactatggtaattattatgcgtccaag
tcattctttgaccctagcaagaaccggagaattatgttgggttgggctaatgaatcagat
actgttgatgacgatgtcaggaaaggatgggccggagtccaccctatcccgcgtaaacta
tggcttgatccaagtggaaagcaattggttcaatggcctgttgaagaattagaaactcta
agaaagaaaaaggtccaactaagtaatcacaagttgtacaagggagaaatgattgaagtc
aaaggaatcacagttgcacaggctgatgttgaagtgactttctcgttcgcaagtttggac
aaggcagaaccatttgatcctagttgggctgatctttacgcgcaagatgtatgcgccatt
aagggttcaacagtccaaggtggacgcgggccatttggactcataactttggcttctaaa
aacttggaagaatacacacttgttttcttcagagtttttaaagctcaagataaatataag
gttcttatgtgctctgatgcatcaaggtcaacccttaagaatgaaacaactatgtacaaa
ccatcatttggtggatatgtggatgtggatttagcagacaagaagttgtctctaaggagt
ttgattgataactcagtagtggaaagttttggtgccggaggaaaaacatgtattacatca
agagtttatccaacattagcaatatttgataaggcacatttatttgccttcaacaatggc
acagaagcaatcacaattgaaactctaaatgcctggagtatggccgatgctaagctgcac
taa

DBGET integrated database retrieval system