KEGG   Nicotiana tabacum (common tobacco): 107811207Help
Entry
107811207         CDS       T04643                                 

Definition
(RefSeq) tRNA wybutosine-synthesizing protein 2/3/4-like
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
nta  Nicotiana tabacum (common tobacco)
Brite
KEGG Orthology (KO) [BR:nta00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nta03016]
    107811207
Enzymes [BR:nta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     107811207
Transfer RNA biogenesis [BR:nta03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    107811207
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TYW3 Kelch_6 Met_10 Kelch_4 Kelch_1 Kelch_5 Kelch_3 Kelch_2 MTS DNA_methylase Cons_hypoth95
Motif
Other DBs
NCBI-GeneID: 107811207
NCBI-ProteinID: XP_016491581
UniProt: A0A1S4BRT6
Position
Un
AA seq 1051 aa AA seqDB search
MEFEKRKAATLASINSPEPDKSPKGNIDAPIIPLLNTLNSHPSYFTTSSCSGRISILSTP
TNPFNNHTRKKAKGGKWVFISHDPIQPHLVLPLLFPTESTQKVNELTQLHSLVFRFEPLI
IAVECKDIESAQFLVSLAISCGFRESGITSVNKKRVIIAIRCSIRLEVPLGDTDKLMVSP
EYVEYLVMLANEKMETNKKRTDIFLDALLKNGFLGTHISNGELLDNGKVECDEVPVCFNT
KESEFLENSLGNGVSGNGNAKRRDLDDSCSGSEVAPEINLHTIKLVISGESIERLFLWGH
SASTLDNKKVLIFGGFGGIGRHARRDDLLLLDLESGRMELIDVLDAPCPRVGHTSSMIGD
SMYVIGGRADPLNILNDVWVFNVTKKDWRLLECSDSPFLPRHRHAAATVGSRIYIFGGIQ
NDITFSSLYVIDTQNFEWSEVQVQGELPCARHSHSMAAYGTRLFVFGGYDGQKALGDLYS
FDVKTCLWKKEKMIGGPAAKFSHSMFIYKKYLGIIGGCPVSQQNQRLSLLNLESHLWKHI
TISSIGEGLFVRSTANIVDNDLIMIGGGAACYAFGTKFSEPVKLDLLPLISLIESPMHLH
EENKHAIYQEEETMREMNISSCFPQNEVEPVNNGSFHQNSEGRDSGIARSQMVASHWVIR
LKRKDAKMAKDMLKKFGWLDLGRKVHSQDDGKDICFPVTENFCSLFNQRNSLGDVPESVC
QEGTPMKDTCISTALNILIECGATILADEIIRVKKASHSPFKVMTEAVASLLSDRGLPLQ
LLEELPSRWERLGDIVVLPITSFKDSAWDLIGQELWFMVAKSLGAHRLARQGRIAPTGTR
DSTLEMLVGDDGWVNHRENGILYSFDATKCMFSWGNLSEKLRMGHFDCKDEVIVDLFAGI
GYFVLPFLVRAKAKLVYACEWNPHAVEALRRNLEANLVADRCVLLEGDNRITAPKGVADR
VCLGLIPISEGSWGTAVRALRDKGGILHIHGNVKDSEETVWTNYVSESIQEITRSEGHYW
EVSVEHVERVKWYAPHIRHLVADVRCKQIET
NT seq 3156 nt NT seq  +upstreamnt  +downstreamnt
atggagttcgagaagagaaaggcagcaactttagcttcaatcaattcaccagaaccagac
aaatcaccaaaaggcaacatagacgcaccaattatccctttactcaacacccttaactca
cacccttcatatttcaccaccagttcttgttctggccgtatctccattctttcaacaccc
accaaccccttcaacaaccacactaggaaaaaagctaaaggaggcaaatgggtcttcatt
tctcacgacccaattcaaccccacttggttttacccctcctttttccaaccgagtcaact
caaaaagtcaacgagttgactcagctacatagcctcgtgttcaggtttgagcctttgatt
attgcagtggagtgtaaggacatagagtcagctcagtttttggtgtcattagctatttca
tgtgggtttagggagagtggtattaccagtgttaacaagaaaagagtgatcattgctata
cggtgttcgattcgattggaagtgccgttaggggatactgataagttaatggtgtctcct
gaatatgtagagtaccttgttatgttagcaaatgagaaaatggagactaataaaaaaaga
actgatatctttcttgatgcattgttgaaaaacgggtttttgggtacacatattagtaat
ggggagcttttagataatggaaaggtggaatgtgatgaggttccagtttgttttaatacc
aaggagtctgaatttttggaaaattctttgggtaatggtgttagtggaaatggaaatgct
aaaagaagagacttagatgattcttgttctggatcagaagtagcccctgaaatcaaccta
cacactattaaattggtgatttctggtgaatcaattgagaggctattcctctggggtcac
tctgcttctacattggataacaagaaggttctcatatttggtggctttggaggaatagga
agacatgcacgaagagatgatctgttgcttcttgatctagaaagtggaaggatggagttg
attgatgtcttggatgccccatgtccacgtgtgggtcatacatcatccatgattggagat
tcaatgtatgtgattggaggaagagctgaccctttaaatattctgaacgatgtgtgggtt
tttaacgtgacaaagaaagattggcggctgttagagtgttcagacagtccattccttcca
aggcatagacatgctgcagctactgtaggttcaagaatttatatatttgggggaattcag
aatgatataacattctcatcactgtatgtcatcgacacacaaaactttgaatggagcgaa
gtacaagttcaaggggaattgccatgtgcacgtcattctcattcaatggcagcatatggg
actcgattatttgtatttgggggatatgatggccaaaaggctctaggggacctgtatagt
tttgatgtgaaaacatgtctttggaagaaagaaaagatgattggaggaccagctgcaaaa
ttttctcattctatgtttatttataagaaatatctcgggatcattgggggctgccctgtt
agtcaacagaaccagagattatcattactcaatttggaatctcatttgtggaaacatatt
actatcagttctattggtgaaggcctgtttgttcgtagtacggcaaatattgttgataat
gaccttataatgattggtggtggtgcagcctgttatgcatttggaacaaagttcagtgaa
ccagtgaaactagatctgttacctttgatatcactaatagaaagtcccatgcatttacac
gaggaaaataagcatgccatttatcaagaggaagaaacgatgagagaaatgaacatttcc
tcttgttttccacagaacgaagtggaaccagtaaataacggaagctttcatcagaattca
gagggtagagattctggaattgctagaagtcagatggttgcttcccattgggttattcgg
cttaaaaggaaagatgcgaaaatggcaaaggatatgctgaaaaagtttggatggttagat
cttgggagaaaggtccattcacaggatgatggaaaggatatctgtttccctgtcacagaa
aacttttgctctttattcaaccagagaaatagcctgggagatgttcctgaatctgtttgt
caagagggaacaccaatgaaagatacctgcatttcaacagcgttgaatattctgattgaa
tgtggagcaactatactagctgatgaaatcatcagagttaaaaaagcttcacattctcca
ttcaaagtgatgacggaagctgtagcctctctgttaagtgaccgaggtctgccgttgcaa
cttttagaggagttaccttcaagatgggaacgacttggtgatattgttgtgcttcctata
acatccttcaaggactcagcatgggacttgattggccaggagctttggtttatggtcgca
aaatccctcggggctcatcgccttgctcgacaagggcgaattgcaccaactggtacgagg
gacagtactttggagatgcttgttggggatgacggttgggtcaaccatcgagaaaatggt
attctttattcttttgatgctactaagtgcatgttctcatggggcaatctctctgagaag
cttcgaatgggccactttgactgcaaagatgaagttatagtagatttgtttgctggtatt
ggatactttgtcctacccttcttagtgagggccaaagccaagctcgtgtatgcttgtgaa
tggaacccccacgcagttgaggcacttcgtcgtaaccttgaagccaatcttgttgctgat
cgttgtgtattactcgaaggagataatagaattacagcaccaaaaggtgtagctgataga
gtatgtctcggtctcattcccataagcgagggtagttggggtactgctgtcagagcatta
agagacaagggtggtatattgcacatccatggcaatgtcaaagattctgaagaaactgtc
tggacaaactatgtttccgagtcaatccaagaaattactagatctgaaggtcactactgg
gaggtatcagtagaacacgtcgagagggtgaaatggtatgcgccccatatccgccatctt
gttgcagatgtgagatgcaagcagattgagacataa

DBGET integrated database retrieval system