KEGG   Nicotiana tabacum (common tobacco): 107813066Help
Entry
107813066         CDS       T04643                                 

Definition
(RefSeq) glutathione peroxidase homolog BsaA-like
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00480  Glutathione metabolism
nta00590  Arachidonic acid metabolism
nta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107813066
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107813066
Enzymes [BR:nta01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     107813066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 107813066
NCBI-ProteinID: XP_016493759
UniProt: A0A1S4BYA0
Position
Un
AA seq 113 aa AA seqDB search
MFLSKGFEIAAFLYDKKETDKEGNEAQKAPPRGQLEINAARFRVFDKVKLNGQRAHPLFV
HLRSKFGRGEPIKTEFHKFLVDRNGVAYKSFPLDTPRQELEDHVKHLLLEDID
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgagcaaggggttcgagattgcagcatttctgtacgataagaaagaaactgat
aaagaaggaaatgaagcacaaaaggcaccaccaaggggacagctagagattaatgctgct
agatttcgagtattcgacaaggtaaaactgaatggtcaaagggcacatccactctttgta
catctaaggtcaaaatttgggagaggagaacccatcaagactgaattccacaagtttctc
gtagacagaaatggtgtagcttacaaaagcttccccttggacacaccacgtcaggagctt
gaggatcacgtcaagcatttactcttggaggatatagattga

DBGET integrated database retrieval system