KEGG   Nicotiana tabacum (common tobacco): 107816085Help
Entry
107816085         CDS       T04643                                 

Definition
(RefSeq) serine decarboxylase-like
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00340  Histidine metabolism
nta01100  Metabolic pathways
nta01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    107816085
Enzymes [BR:nta01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     107816085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 107816085
NCBI-ProteinID: XP_016497241
UniProt: A0A1S4C810
Position
Un
AA seq 487 aa AA seqDB search
MVGTSAVIESVSSAVIGKEVAADSRLDLTTVAEPVPPVVKSDDVDGAVNDGEEQKREIVL
GRNIHTTCLAVTEPDADDESTGDKEAYMASVLARYRKTLTDRTKYHLGYPYNLDFDYGAL
TQLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKNEYWGYITNCGTEGNLH
GILVGREVFPEGILYASKESHYSVFKAARMYRMECVKVDTLLTGEIDCADFKVKLLANKD
KPAILNVNIGTTVKGAVDDLDLVIKTLEECGFSHDRFYIHCDGALFGLMMPFVKRAPQVT
FKKPIGSVSVSGHKFVGCPMPCGVQLTRLEHINALSRNVEYLASRDATIMGSRNGHAPLF
LWCTLNRKGYKGFQKEVQKCLRNAHYLKDRLIGAGISAMLNELSSTVVFERPKDEEFVRK
WQLACERNMSHVVVMPSVTVEKLDDFLDELVKARSIWYKDENVKPPCLAADIGSQNCCCP
QHRGRNS
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggtaggaacaagcgcagtaattgaatcggtcagctccgctgtgatcggaaaagaggtg
gcagcggacagtcgacttgatctgacgactgtggcggagccggtgccgccagtggtgaaa
tcggacgatgtagatggcgcggttaatgacggtgaggagcagaagagggagattgtgtta
gggcggaacatacatacaacgtgcttagctgttacggaacctgatgctgatgatgaatct
accggtgataaggaagcctatatggctagtgttttggctcggtatcggaagactcttact
gatcgaactaagtaccatttagggtatccatataatttggactttgattatggtgcactc
acacagttgcagcatttttccatcaataacttgggggatccattcattgagagtaattat
ggtgtgcactcaaggcagtttgaagttggggttttggactggtttgcacgcctatgggaa
atagagaagaatgaatattggggatacatcacaaactgcggaactgaaggaaatcttcat
ggaatccttgttgggagagaagtatttcccgaaggaattttgtatgcttcgaaggagtct
cattattctgtttttaaagcagcacgaatgtatagaatggaatgtgtgaaggttgacact
ctactaactggtgaaatagattgtgcagacttcaaagttaagctactagcaaacaaggac
aaacctgcaatcctcaatgtcaacatcgggactactgtgaaaggagccgtcgatgatctt
gatctcgtcataaaaacccttgaagagtgcgggttttcacatgatcggttttatatccac
tgtgatggggctctctttggtcttatgatgccatttgtcaagcgtgcaccgcaggttact
ttcaaaaagccaattggtagtgtgagcgtctctggtcacaagtttgtgggatgtccaatg
ccatgcggtgttcaactgacaaggttggagcacattaatgccctttctaggaacgtggag
taccttgcttcaagggacgccactatcatgggaagtcggaatgggcatgctccacttttc
ctttggtgcaccctgaacagaaaagggtacaagggattccagaaagaagtccagaagtgc
ctaaggaatgctcattacttaaaagatcgccttataggagctggaatcagtgctatgctg
aatgaactgagcagcacagttgtttttgagcgacctaaagatgaggaatttgttcgcaag
tggcaacttgcttgtgaaagaaatatgtcacatgttgtcgtaatgcctagtgtcacagtc
gaaaagctggatgacttcttggacgagttagttaaagcacgatcaatctggtacaaggat
gagaacgtcaagcctccttgtctagctgcagatatcgggagtcaaaactgttgctgccct
cagcacaggggacgtaattcttag

DBGET integrated database retrieval system