KEGG   Nicotiana tabacum (common tobacco): 107819996Help
Entry
107819996         CDS       T04643                                 

Definition
(RefSeq) putative pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00790  Folate biosynthesis
nta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    107819996
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nta04147]
    107819996
Enzymes [BR:nta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     107819996
Exosome [BR:nta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107819996
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-GeneID: 107819996
NCBI-ProteinID: XP_016501686
UniProt: A0A1S4CKX6
Position
Un
AA seq 244 aa AA seqDB search
MDFQVYPKEYNNKINTTRKYVQFGSAHSHIEVNLPEPKRPLFSADVSMIRTLQARLAILS
NASFLQVSLASLSQSFSRNHGSSNIRVAGAGVVCSQVAVSANTNTHNGIKTLCSAEDLST
KKCVPCNAKDLRPMSEEAANQLMWQVTGWDLLNDGGTLKLHRSWKVKTFSKGLEFFQEVA
NVAEAEGHHPDLHLVGWNNVIIDIWTHSVGGLTENDFILAAKINGLDVQHLLSKKTAKSA
QSSA
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggattttcaagtttatccaaaagaatataataacaaaataaacactacacgtaagtat
gtccagttcggctcggcgcattcgcatatagaggttaatctgccagaacccaaacgtccc
cttttttccgcagacgtgtcgatgattcggacgcttcaagctcgtctggcaattctctcc
aacgcttcatttcttcaggtatcgttggcatcactatcccaaagcttctccagaaaccat
ggaagctcaaatatacgtgtggctggagctggggtagtgtgcagtcaggttgcagtgtca
gcaaatactaacacacataacgggattaagactctgtgttcagctgaagatttgtcaact
aagaagtgtgtgccatgcaacgcaaaggatttgaggcctatgagtgaagaagctgcgaac
cagttgatgtggcaggtgacaggttgggatttgctgaatgatggtggcacactaaagctg
catagatcctggaaagtcaagactttcagcaaaggattagagttctttcaagaggtagca
aatgttgcagaagctgaaggtcatcatccagatcttcatctcgttgggtggaataatgtg
ataattgacatatggacgcattctgtgggtggactcacagaaaatgatttcatacttgct
gccaaaattaatgggcttgacgtgcagcaccttctcagcaagaaaactgccaaatcagca
caaagcagtgcttaa

DBGET integrated database retrieval system