KEGG   Nicotiana tabacum (common tobacco): 107821449Help
Entry
107821449         CDS       T04643                                 

Definition
(RefSeq) (-)-germacrene D synthase-like
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    107821449
Enzymes [BR:nta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     107821449
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth PSP1
Motif
Other DBs
NCBI-GeneID: 107821449
NCBI-ProteinID: XP_016503371
UniProt: A0A1S4CQN6
Position
Un
AA seq 553 aa AA seqDB search
MDGFAGEAEVTRRCGNHHPTVWGDHFLAYSHLSGANEWEKKQHEHLKEEVRKMLVMAPSK
SLQNLDLINAIQCLGVAYHFEHEIEESLAFIYSCYDQLNGEADETDLHTVALRFRLLRQH
GYYVSSDVFRKFTDDQGNYKKALVGDVQGLLSLYEATQFRVHSEEILGEAVNFTTTHLKL
LLPTLSNSFAMKISNALKYPINCTMVTAATRKYISFYQEDKAHDDVLLNLAKLDYNILQK
MYKTELCDITRWWKELDFTKALPFTRDRVVELYFWSLSVYFEPQYKVGRNILTKVLCFIS
IADDIYGTYGTIDELTLLTNAIERWNIDDISEKLPSYMKLYYLALLDVYSEIEKELAKEN
KSFQLNYSIAEMKKLIKAYFQEAKWYHGNNVPTMEQYVKNGIRSSTIPCLVTLSWLGIGN
EATKEAHDWLASEPPILVASSIIARLSNDIVSHEREQEGGDISGVVCYMNEYGVTKEEAY
MEIRKIMDNSWKDLNRECLKPIVIPRVLLMPVLNLARMSEFSYKDEDSYTFSKNNLKDII
SERRNFKVSKKVE
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggatggatttgctggtgaggctgaggttacacggcgctgtggcaatcaccatcctact
gtttggggagaccattttcttgcctattctcatctctcgggagccaatgaatgggaaaag
aaacagcatgagcacctaaaggaagaagtgagaaaaatgctagtgatggctccttccaaa
tcgttgcaaaatctggatctgataaacgcaatccaatgtcttggagtagcgtaccatttt
gaacatgagattgaggagtcactggcctttatctatagctgttatgaccaattgaatggt
gaagctgatgaaactgaccttcatactgttgctctgcggtttcgattacttaggcaacac
ggttattatgtctcatctgatgtttttaggaaattcactgacgaccaaggaaattacaag
aaagcattggttggcgacgtgcaaggattgttgagcctgtatgaggcaacacaattcaga
gtacacagtgaagaaatactaggcgaagcagttaatttcaccaccactcatttgaagcta
ttattgcctacattgagtaattcattcgcgatgaaaatcagcaatgcactaaaatatcca
atcaactgtactatggtgacagcagcaacgaggaaatacatatcgttttaccaagaagat
aaagcacatgatgatgtgttgctaaatttggcaaaattggactataacatattgcagaag
atgtataaaactgagctatgtgatatcacaaggtggtggaaggaattggacttcacgaaa
gcattaccttttacaagagacagagtagttgagttgtacttctggtctttgagtgtgtac
tttgagccccagtataaggtggggaggaacatactaaccaaagtgttatgcttcatttct
attgctgatgatatctatggtacatatggaacaatagacgaactcactctcctaacaaat
gcaatagaaaggtggaacattgacgacatttcagaaaagttaccatcatatatgaagctt
tattacctagctcttctagatgtttacagtgaaattgagaaagaattggcaaaggaaaac
aagtcatttcaactcaattattcaatagctgagatgaaaaagctaataaaggcatatttt
caagaggccaaatggtatcatgggaataacgtcccaactatggagcagtatgtgaaaaat
ggaattcgatctagcactatcccatgtcttgtgactctctcttggttaggcattggaaat
gaagcaacgaaggaggcacacgactggcttgcaagtgaacctccaattctggttgcttcc
tctatcatcgctagattatcgaatgatattgtatcacatgagagagagcaagaaggagga
gatatatcaggtgtcgtatgttacatgaatgaatatggcgtcacaaaggaagaagcatac
atggagattaggaaaataatggataatagttggaaggatttgaatcgagaatgcctaaaa
cctatcgttataccgagggttttactcatgccagtgctcaaccttgctaggatgtcggag
ttctcatacaaagatgaagattcttatactttttccaaaaacaacttgaaagacatcatc
tctgagaggaggaacttcaaagtgagcaaaaaggttgagtag

DBGET integrated database retrieval system