KEGG   Nicotiana tabacum (common tobacco): 107822811Help
Entry
107822811         CDS       T04643                                 

Definition
(RefSeq) magnesium protoporphyrin IX methyltransferase, chloroplastic-like
  KO
K03428  magnesium-protoporphyrin O-methyltransferase [EC:2.1.1.11]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00860  Porphyrin and chlorophyll metabolism
nta01100  Metabolic pathways
nta01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    107822811
Enzymes [BR:nta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.11  magnesium protoporphyrin IX methyltransferase
     107822811
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mg-por_mtran_C Methyltransf_25 Methyltransf_23 Methyltransf_12 Methyltransf_31 Methyltransf_11 MTS PrmA Methyltransf_18 Ubie_methyltran Methyltransf_32 CMAS Methyltransf_9 TehB tRNA_U5-meth_tr
Motif
Other DBs
NCBI-GeneID: 107822811
NCBI-ProteinID: NP_001313034
UniProt: Q9MUE2
Position
Un
AA seq 325 aa AA seqDB search
MAFSSPLFSPVNFALNPNPQIHPKCTKPNRRNFSVCAIPPLSTATDISAVTGPLDGTTLA
VLGGGSVAALAAILSLADPERRRQLQAEEVGGGDKEVVREYFNNNGFQRWKKIYGDTDDV
NKVQLDIRLGHSKTVENVMKMLTEEGSLQGVTVCDAGCGTGCLSIPLAKEGAVVSASDIS
ASMVAEAQKQAQEELFKDKDDQSPAPVMPKFEVKDLESLDGKYDTVVCLDVMIHYPQSKA
DGMIAHLASLAENRLILSFAPKTFYYDLLKRIGELFPGPSKATRAYLHAEADVERALQKA
GWKIRKRGLIATQFYFAKLIEAVPA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggctttctcttcgccactattctctcccgttaacttcgccttaaaccctaaccctcaa
attcatcctaaatgcactaaacccaaccgccggaacttctctgtctgcgccattccgcca
ctctctactgcaaccgacatatcggcggtcaccggtccgttggacggaacgactctcgcc
gtactcggcggtggttccgtggcagcacttgcagctatcctctcgcttgccgaccccgaa
cgccggcggcaactgcaagcggaggaggtcggcggcggcgacaaagaggtggtgagagag
tatttcaacaacaatgggtttcagaggtggaagaagatatatggcgacacggatgatgtg
aacaaagtgcagttggatataagactgggacactctaaaactgttgagaatgtgatgaaa
atgttgactgaagagggctctcttcagggagttactgtctgcgacgctggttgtgggacc
ggttgtttatccattcctttagccaaagaaggtgctgttgtatcagctagtgatatttca
gcttcgatggtcgctgaagcccaaaaacaggcgcaagaggagttgttcaaggataaggat
gaccagtccccggcaccagtaatgccaaaatttgaagtgaaggacttggagagtttggat
ggaaagtatgacaccgtggtctgcttagatgttatgatacattacccacaaagtaaggct
gatggtatgattgctcatcttgcgtcattggctgagaatcgtttgatcctgagcttcgcc
ccaaagacattctattatgatttgttaaaaagaatcggagagttgttccctggaccttca
aaggctacacgagcatatcttcatgcagaggctgacgtggagagggcactgcaaaaagct
gggtggaagataaggaagagaggcttgattgccacacaattttactttgcaaagcttatt
gaggctgtccctgcttag

DBGET integrated database retrieval system