KEGG   Nicotiana tabacum (common tobacco): 107823578Help
Entry
107823578         CDS       T04643                                 

Gene name
CCD4
Definition
(RefSeq) probable carotenoid cleavage dioxygenase 4, chloroplastic
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00906  Carotenoid biosynthesis
nta01100  Metabolic pathways
nta01110  Biosynthesis of secondary metabolites
Module
nta_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    107823578 (CCD4)
Enzymes [BR:nta01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     107823578 (CCD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 107823578
NCBI-ProteinID: NP_001313051
UniProt: F8UWS2
Position
Un
AA seq 601 aa AA seqDB search
MDAFSSTFLSTLSQHPKSLLSPNYSPNTSSSPILKVSSVRIEERPQTTTTTTRTKPQEKP
TPSPYTPPKDTPKRQLPTKSITTKKPVEPSFPSVIFNAFDDFVNTFIDPPLKPCVDPKYI
LSNNFAPVDELPPTECEVVVGSLPPCLDGAYIRNGPNPQYLPRGPYHLFDGDGMLHSIKI
SQSKATLCSRYVKTYKYTIEREAGSPVFPNVFSGFNGLTASAARGAITAARAIAGQFNPT
NGIGLANTSLALFGGKLFALGESDLPYAVKLAPDGDIITLGRYDFDGKLFMSMTAHPKID
PDTNEAFAFRYGPMPPFLTYFRIEPNGTKTPDVPIFSMTRPSFLHDFAITNKFAIFSDIQ
IGMNPLEFITGGSPVSSDSGKIPRLGVIPRYAKNESEMKWFDVPGINIVHAINAWDEDDG
DTIVMVAPNILSVEHTLERMDMIHASVEKVKIDLKSGMVSRQPLSTRNLDFGVINPAYVG
KKNKYVYAAIGDPMPKIAGIAKLDVSVAEADRRDCIVACRLFGEGCFGGEPYFVANNSAA
DEDDGYVVSFVHNEKTGESRFLVMDAKSPNLDIVAAVKLPRRVPYGFHGLFVRETDLRKL
M
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggatgccttctcttccactttcctttctacattatcacaacaccctaaatctcttctt
tctcctaattattctcccaacacatcatcttctcctattcttaaggtctcctccgttaga
attgaagaaaggccacaaacaactacaaccactactagaaccaaaccacaagaaaagcca
accccatcaccctacactcctccaaaagacactcccaaaagacaattacctacaaaatca
ataaccacaaaaaaaccagtagagccatcgtttccatcagttatcttcaatgcatttgac
gatttcgtgaacactttcattgatcctcctttgaaaccttgtgtcgatccaaagtatatt
ctctctaacaactttgctccggtggatgagcttccccccactgaatgcgaggtcgtggta
ggctcccttcctccttgccttgacggcgcgtacatccgaaatggccccaatcctcagtat
cttccacgtggaccttaccatctttttgatggagatggaatgcttcattccattaaaatt
tctcaaagcaaagctacactctgcagccgatacgtcaaaacttacaaatacacaattgaa
cgtgaagctggttctccggttttcccaaatgtattctccggtttcaacggtctcactgcc
tcggcggcgcgtggtgctatcaccgcggctcgagcgattgcgggacagttcaatcccact
aacggcatagggctagcaaacacaagcttggctttattcggaggcaaactattcgctctt
ggtgaatctgatttaccgtatgcagtaaaattagccccagatggtgatattattaccctc
ggccgttacgatttcgacggaaaacttttcatgagcatgacggcacatcccaaaattgac
ccagatactaacgaggcttttgctttccgttacggtccaatgcctccttttttaacttac
tttagaatcgaaccaaatggtacaaaaacaccagacgtgccaatattttctatgacacgt
ccgtcatttcttcatgactttgcaattacaaataaatttgcgatattctcggacatacaa
ataggaatgaacccacttgagttcatcaccggtggttcaccggtgagttcagactcgggg
aaaatccctcgccttggcgtgattccacgttacgccaagaacgaatcggaaatgaagtgg
tttgatgtgcccgggatcaatattgtacatgcgattaatgcgtgggatgaagatgatggt
gatactatagtgatggtagcgcctaatatattgtcggtggagcatacgctggagagaatg
gatatgatacatgcttctgttgagaaagtgaagatagatttgaagagtgggatggtgagc
agacaaccattgtcgacaagaaatcttgattttggagtcatcaatccggcttatgttggg
aagaagaacaagtatgtatatgcagcgattggagaccctatgccaaagatagcaggcata
gcaaaattggacgtatcagtagcagaagctgatcggcgcgattgcatagtggcgtgccga
ttatttggagaaggctgctttggcggtgagccatattttgtggcaaacaattcagcagcg
gatgaggacgatggctacgttgtgtcgtttgtgcacaatgagaagacaggagagtcaagg
ttcttggtcatggatgcaaagtcccctaatcttgacattgtggctgctgtcaaattgcct
cgtcgagtgccttacggtttccacggccttttcgttagggaaactgatcttaggaaactc
atgtag

DBGET integrated database retrieval system