KEGG   Nicotiana tabacum (common tobacco): 107824843Help
Entry
107824843         CDS       T04643                                 

Definition
(RefSeq) palmitoyl-acyl carrier protein thioesterase, chloroplastic-like
  KO
K10781  fatty acyl-ACP thioesterase B [EC:3.1.2.14 3.1.2.21]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00061  Fatty acid biosynthesis
nta01100  Metabolic pathways
nta01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    107824843
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nta01004]
    107824843
Enzymes [BR:nta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.14  oleoyl-[acyl-carrier-protein] hydrolase
     107824843
    3.1.2.21  dodecanoyl-[acyl-carrier-protein] hydrolase
     107824843
Lipid biosynthesis proteins [BR:nta01004]
 Fatty acid synthase
  Component type
   107824843
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-ACP_TE Acyl-thio_N 4HBT_2
Motif
Other DBs
NCBI-GeneID: 107824843
NCBI-ProteinID: XP_016507137
UniProt: A0A1S4D140
Position
Un
AA seq 414 aa AA seqDB search
MVVTAATGAFFPVANPPPESGGAKPSGKVGGSLPGSIDARGLNAKKPAFGSLQAKANAQA
PPKVNGTKVGIMDGLKTDDEVFSSPPPRTFANQLPDWSMLLAAITTIFLAAEKQWMMLDW
KPKRPDMLVDPFGLGKIVQDGLVFRQNFSIRSYEIGADRTASIETMMNHLQETALNHVKC
AGLMHGGFGSTPEMSKRNLIWVVTKMQVVVDRYPTWGDVVQVDTWVAASGKNGMRRDWLV
RDSSTGHVLMRASSLWVMMNKETRRLSKIPEEARAEIEDYFVDSPPVIDDDSRKLPKLDE
TTADYIRTGLTPRWSDLDVNQHVNNVKYIGWILESAPMQILEGCELAAMTLEYRRECRRD
SVLQSLTSVLDKGVGDLDDIGNVQCQHLLRLENGGEVVKGRTEWRPKRAINGIG
NT seq 1243 nt NT seq  +upstreamnt  +downstreamnt
atggtggtcactgctgctactggcgcattctttcctgttgctaatccacctcctgaatct
ggtggagcaaaaccatctggaaaggtaggaggaagtcttcctggaagtatagatgcacgg
gggctcaatgctaagaagcctgcttttgggagtctacaagctaaggccaatgctcaagct
cctcctaaggtgaatggaacaaaggtaggcattatggatggcctcaaaactgatgatgag
gtgttttcttcacctccaccaaggacctttgcaaaccagttgcctgattggagcatgctc
cttgctgccatcacaactatctttttggctgctgagaagcaatggatgatgcttgattgg
aagcccaagcgtcctgatatgctcgttgacccattcggtttaggaaagattgtgcaggat
ggccttgttttccgtcaaaattttagcatcaggtcctatgaaataggggctgataggact
gcgtctatagaaacgatgatgaatcatttacaggaaactgctcttaaccatgtcaagtgt
gcgggactcatgcatggtgggtttggatcgactccagaaatgtccaagagaaatttgatt
tgggttgttaccaaaatgcaggttgtagtggatcgctatcctacttggggtgatgttgtt
caagttgacacttgggtggctgcatcagggaagaatggtatgcggcgagattggcttgtc
cgtgatagtagtacagggcatgtattgatgagagcatccagcttatgggtgatgatgaat
aaggagacaaggagattatctaaaataccggaggaggctcgggctgaaattgaagattat
tttgttgattcacctcctgttattgacgatgacagccggaagttaccaaaacttgacgag
acaacagcagactacattcgaactggtttaactccaagatggagtgacttagatgttaac
cagcatgttaataatgtcaagtacattggctggattcttgagagtgcacccatgcaaata
ctggaaggctgcgagctcgcggccatgacattggagtaccgaagggaatgcagaagggac
agtgtgctgcagtcactgacctctgtactggacaagggtgtcggtgacttggatgacatt
gggaatgttcagtgtcaacatttgcttcgactcgaaaatggtggagaggttgttaagggg
cggactgagtggaggccaaaacgtgccatcaatggaattggga

DBGET integrated database retrieval system