KEGG   Nicotiana tabacum (common tobacco): 107825222Help
Entry
107825222         CDS       T04643                                 

Definition
(RefSeq) probable glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00480  Glutathione metabolism
nta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107825222
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nta02000]
    107825222
Enzymes [BR:nta01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     107825222
Transporters [BR:nta02000]
 Other transporters
  Pores ion channels [TC:1]
   107825222
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3 GST_N_4 GST_C_6
Motif
Other DBs
NCBI-GeneID: 107825222
NCBI-ProteinID: XP_016507537
UniProt: A0A1S4D290
Position
Un
AA seq 221 aa AA seqDB search
MAKEDLRLLDFWVSPFCMRVKIALAEKGLAYDSQEEDLLGGKSELLLKSNPIYQKVPVLL
DSGKPIVESSNIVYYIDEKYVTQNPLLPSCAYGRSRARFWADFIDKKIYEAGMAIWRSKG
EELEIAKKDFIDILKKLEGALGDKDYFGGDNFGYVDIIAISMTSWFYAYEKFGGFKVEKE
CPKFDEWTKRCLKRESVANVLPNPEKVYEFVVMLRKMHGIE
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaggatttacgtctattagatttctgggtgagtccattttgcatgagggta
aaaattgcattagctgagaagggtttagcctatgattctcaagaagaagacttgctaggt
ggcaagagtgaactgcttctaaaatcaaaccccatttaccaaaaagttcctgttttattg
gacagtggcaagccaattgtggagtcctcaaatattgtctattatattgatgagaaatat
gttacccaaaatcctttgctcccttcttgtgcttatggtcgttccagggcacggttttgg
gctgacttcattgacaaaaagatttatgaagcaggaatggctatatggaggagcaaagga
gaagaactagagattgccaagaaagatttcatagacattttgaagaaacttgaaggagct
ttaggtgacaaagattattttggaggagacaactttggatatgttgatatcatagctatt
agcatgacatcttggttctatgcttatgaaaaatttggaggttttaaggttgaaaaagag
tgtccaaaatttgatgaatggacaaagagatgccttaagagggagagtgttgctaatgta
cttcctaaccctgaaaaagtttacgagtttgttgtcatgcttaggaaaatgcatggcatt
gaatag

DBGET integrated database retrieval system