KEGG   Nicotiana tabacum (common tobacco): 107831021Help
Entry
107831021         CDS       T04643                                 

Definition
(RefSeq) uncharacterized LOC107831021
  KO
K17434  large subunit ribosomal protein L53
Organism
nta  Nicotiana tabacum (common tobacco)
Brite
KEGG Orthology (KO) [BR:nta00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:nta03011]
    107831021
Ribosome [BR:nta03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    107831021
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRP_L53 L51_S25_CI-B8 Hema_HEFG
Motif
Other DBs
NCBI-GeneID: 107831021
NCBI-ProteinID: XP_016514218
UniProt: A0A1S4DLE8
Position
Un
AA seq 128 aa AA seqDB search
MLKFLSKVKIQFNALDPRTASCMEFLAQCNAPKAKESNPSCQVQVKRRTDDQPPEITVTF
VNGIEQTYDATSTPAQNIRTMILEKGQYLETEQMFREAGEKWPVIIPDEELQQPFLGIKP
KKAEEKKQ
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagttcttgtcaaaggtgaagatccagttcaatgccctagacccacgcacagct
tcatgtatggagtttttggctcagtgtaatgctcctaaagccaaagaatctaatccaagc
tgtcaagtacaggtcaagcgccgcacggatgaccaacctcccgaaatcactgtcaccttc
gtcaacggaatcgagcaaacctatgatgccacttctacacccgcacagaacatccgtacc
atgattcttgaaaagggtcagtatcttgagactgaacagatgttccgtgaagctggtgag
aagtggcctgttattattcctgatgaagagctccaacaaccatttcttggtataaagcca
aagaaggcagaagagaagaagcaatga

DBGET integrated database retrieval system