KEGG   Nicotiana tabacum (common tobacco): 107831087Help
Entry
107831087         CDS       T04643                                 

Definition
(RefSeq) monofunctional riboflavin biosynthesis protein RIBA 3, chloroplastic-like
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00740  Riboflavin metabolism
nta00790  Folate biosynthesis
nta01100  Metabolic pathways
nta01110  Biosynthesis of secondary metabolites
Module
nta_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    107831087
   00790 Folate biosynthesis
    107831087
Enzymes [BR:nta01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     107831087
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     107831087
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_cyclohydro2 DHBP_synthase
Motif
Other DBs
NCBI-GeneID: 107831087
NCBI-ProteinID: XP_016514299
UniProt: A0A1S4DM93
Position
Un
AA seq 526 aa AA seqDB search
MDCIVFKNPSFPRIFISSKFFGTCQNIVGFGQYRKRTVFTTCCSAEINPFESNQNGSVFD
GLNDQNSSVPFETLSAEITPETIDFFVSEAEGDPDCPTSGYSSIEEALTALREGKFVIVV
DDESGEVEGNLVMGASFASAEGIAFMVRHGSGIISVGMKEEDLERLKLPLMSPEKEDDSS
APSFTITVDAKVGTSTGVSASDRAKTVLALSSPTSSPEDFRRPGHVFPLKYRNGGVLRRF
GHTEASVDLVMSAGLQPVSALSTIVDKSDGSIATMPILENLALAHKIPIISITDLVRYRR
KRENLVERTAVSRLPTKWGLFEAYCYRSKLDGTEHIAVVKGDIGNGQDVLVRVHSECLTG
DIFGSRRCDCGNQLDLAMQLIEEAGRGVVIYLRGHEGRGIGLGNKLQAYNLQDQGHDTVE
ANLELGFAADAREYGIGAQMLRDIGVRTMRLMTNNPAKFTGLKGYGLAVVGRVPVLTPFT
EENRKYLETKRTKMSHIYGSDVQGPIKASINQSLKKQDPPQERKES
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggattgtatcgtgtttaaaaatccatcatttccaagaatcttcatcagctcaaaattt
tttgggacttgtcaaaatattgttggatttgggcaatacagaaaaagaacagtatttact
acatgctgttctgctgaaattaacccatttgaaagcaatcaaaacggttctgtatttgat
ggtttgaatgatcagaattcttcagttccatttgaaacattgagtgctgaaataacacca
gaaactattgatttctttgtgagtgaagctgagggtgatcctgattgtcccactagcggt
tattcttcaattgaagaggcacttactgcattacgtgaaggaaagtttgtgattgttgta
gatgatgaaagtggggaagtggaaggaaaccttgtaatgggagcatcctttgctagtgca
gagggaattgcattcatggtaagacatggatcaggcattatttctgtgggaatgaaagaa
gaggatcttgaaagactcaagcttcctttaatgtcacctgaaaaagaagatgattcttct
gctccatccttcacaatcacagtggatgcaaaggtgggaacatctactggtgtatcggct
tcagatagggctaaaactgtgcttgcattgtcatctcctacttctagtcctgaagatttc
agaaggccagggcacgttttccccctcaagtatcgaaatggtggggtcttaagaagattt
ggtcatactgaggcttctgttgatttagtaatgtcagccggcttgcaaccagtttctgct
ctttcaactatagttgataaaagtgatggttcaatagccaccatgcccattttggaaaat
ttggccttggcgcacaagattcctattatctcaataactgatttagtaagatataggaga
aagagggaaaatcttgtcgaaagaactgcagtgtcacgtttaccaactaaatggggatta
ttcgaggcttactgctaccgttcaaagcttgatggaacagaacatatagctgttgtaaag
ggtgatatcgggaatggtcaagatgtgttggtaagggtacactcggagtgtttgacgggg
gacatatttggatctagacgatgtgattgtggtaatcagctggatttggcaatgcagttg
attgaggaagctggtagaggtgtggttatctatctcagaggccacgaaggaagaggcatt
ggcctcggtaacaagcttcaggcctataacttgcaagatcaaggtcatgatactgttgaa
gccaatttagaactcggctttgctgcagatgctcgtgaatatggcattggtgcacagatg
ttgagggatataggagttcgtaccatgcgcttaatgactaacaatccagcaaaatttacc
ggtctaaagggctatggtttagctgtcgttggacgagtaccagttttgacacccttcaca
gaggaaaacaggaagtatttggaaacaaaacgaacaaaaatgagtcatatatatggatct
gatgtgcagggaccaattaaggcgtccatcaaccaaagtttaaagaaacaagatccgccc
caggaaagaaaagaaagttga

DBGET integrated database retrieval system