KEGG   Novosphingobium tardaugens: EGO55_02795Help
Entry
EGO55_02795       CDS       T05741                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ntd  Novosphingobium tardaugens
Pathway
ntd00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ntd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    EGO55_02795
Enzymes [BR:ntd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     EGO55_02795
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     EGO55_02795
    1.1.1.-  
     EGO55_02795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AZI35013
UniProt: U2Y5Z9
Position
complement(575661..576695)
Genome map
AA seq 344 aa AA seqDB search
MQSANYIDPGKIEARDDATRPVPAPGEVLIAVEACGICGSDLHMYRNNSYRHSLVRKTPE
GYDVPGHEFAGRIAELGEGVEGWAVGEKVVGVTGYGGGMAQFVTVPVNPFQLVRIPEGVS
FAEAATTEPMADGLQMVRKAEIKPGENVMVFGVGIIGLGVIQAIRAKCPDVGRVIAIDVQ
DVRLQAALDVGASDTINPRNADIFDAAVALCGGEDDYRGKSAKIDVVIDCAGYIPHIPGP
PPLEIALRCIANRGGRIVCFGAYEDKMLIDFSYVIKKEPVIIGSNGYAPEELVEALEMMQ
RGQVDRKSLISHSYQLSEIAEAFEKQGMPEAVKVMLEIPQHAAA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcagccaattatattgatcccggcaagatcgaggcccgcgatgacgcgaccagg
cctgtgcccgcgccgggggaagttctgatcgcggtggaggcttgcggcatttgcggatcg
gacctgcacatgtaccgtaacaacagctatcgccattcgctcgttcgcaaaacgcccgaa
ggctatgatgtgcctggtcacgaattcgccgggcggatcgcggaactgggcgaaggggtc
gaaggctgggccgtcggcgagaaggtcgttggcgtcaccggctatggcggcggcatggcg
cagttcgtgacagtgccggtcaacccgttccagcttgtccgcatcccagaaggggtgagc
tttgcagaagcggcgactaccgaaccgatggcggacgggttgcagatggttcgcaaggcg
gagatcaagccgggcgaaaatgtcatggtgttcggcgtcgggattatcggtcttggcgtc
atacaggccattcgcgccaaatgtccggatgtgggcagggtgatcgccatcgatgtgcag
gacgtgcgcttgcaggccgcgctggacgtcggggcgagcgatacgatcaacccgcgcaat
gccgatatcttcgatgccgccgtggccctgtgtggcggagaagacgattatcgcggcaag
tccgccaaaatcgacgtggtgatcgattgtgccgggtatattccgcatattccggggccg
ccaccgctggaaatcgcgctgcgctgcattgccaatcgcggcgggcggatcgtgtgtttc
ggggcttacgaagacaagatgctgatcgatttcagctatgtcatcaagaaggagccggtg
atcatcggttcgaatggctatgcccccgaggaactggtcgaggcgctggagatgatgcag
cgtgggcaggtggatcgcaaaagcctgatctcgcactcctatcaattgagcgagattgcc
gaggctttcgaaaagcagggtatgcccgaagcggtgaaagtgatgctggaaattccgcag
cacgccgccgcctga

DBGET integrated database retrieval system