KEGG   Novosphingobium tardaugens: EGO55_05625Help
Entry
EGO55_05625       CDS       T05741                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ntd  Novosphingobium tardaugens
Pathway
ntd00010  Glycolysis / Gluconeogenesis
ntd00020  Citrate cycle (TCA cycle)
ntd00620  Pyruvate metabolism
ntd01100  Metabolic pathways
ntd01110  Biosynthesis of secondary metabolites
ntd01120  Microbial metabolism in diverse environments
ntd01130  Biosynthesis of antibiotics
ntd01200  Carbon metabolism
Module
ntd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ntd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EGO55_05625
   00020 Citrate cycle (TCA cycle)
    EGO55_05625
   00620 Pyruvate metabolism
    EGO55_05625
Enzymes [BR:ntd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     EGO55_05625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N
Motif
Other DBs
NCBI-ProteinID: AZI35506
Position
complement(1242464..1243771)
Genome map
AA seq 435 aa AA seqDB search
MTIEVKMPALSPTMEQGTLAKWLVKEGDTVVSGDILAEIETDKATMEFEAVDEGTILSIA
VPEGTEDVKVGTVIATLGAEGETAAPAPKAPAPKVADEPAAKAAEPVAAPAPAPAAEARP
APARAAVPKAAEKGDRIVASPLARRIAEQTGIDLAGVQGSGPNGRIVKADVVDAKPGTAV
PVAAAPAPTGQPVATSLTDALPDFGIPFEDVKLSGMRKVIARRLTESKQQVPHIYLTVDV
RLDALLALRGELNAALAARHIKLSVNDMLIKALGVALMQVHACNVSFAGDVMRQYKRADV
SVAVSIPGGLITPIVTDVAAKGLAQISTEMAELAAKAKDGKLQPHEYQGGTASLSNMGMM
GIKQFDAVINPPQAMILAIGAGEKRPWVMEDGTLGVATVMSVTGSFDHRAIDGADGAQLM
TAFRELVEKPLGLAA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgaagtgaagatgcccgcgctttcccccacgatggagcaagggacactggcc
aagtggctggtgaaggaaggggacaccgttgtttcgggcgatattcttgcggagattgaa
accgacaaggcgacgatggaattcgaggcggttgacgaggggacgattctttcgattgcg
gtgcccgaaggcactgaagacgtgaaagtcggcacggtgattgcgacgctgggtgcggaa
ggggaaacggctgcgcctgcgcccaaggcacctgcaccgaaggttgcggacgagccggcg
gccaaagcggcggaaccggttgcggcgcctgcgcctgcccccgcggcagaggccaggccc
gccccggcgcgtgcggcggtgcccaaggctgcggaaaagggcgatcgcattgtcgcatcg
cctttggcccggcggattgcggagcagacgggtatcgatctggccggtgtgcagggcagc
ggccccaatggcaggatcgtcaaggcggatgtggtcgatgcgaaaccgggcacggctgtg
cctgttgccgccgctcctgcccccaccgggcaacctgtggccacgtcgctgacggatgcc
ctgcctgatttcggcattccgttcgaggatgtgaagctgtccggcatgcgcaaggtgatt
gcgcgccgcctgaccgaatccaaacagcaggtgccgcatatctatctgaccgtggacgtg
cggcttgatgccttgctcgcgctgcgcggggaactgaatgcggctctggccgcgcgccat
atcaagctttcggtcaacgacatgctgatcaaggcgctgggtgtggcgctgatgcaggtg
catgcctgcaacgtgtcctttgccggcgatgtgatgcggcagtacaagcgggcggatgtc
tcggttgcggtgagcattccgggcggtctgatcaccccgattgtcaccgatgttgcggcc
aaggggctggcgcagatttcgaccgagatggccgagcttgcagccaaggcgaaggacggc
aagttgcagccgcacgaatatcagggcggcacggccagcctgtcgaacatgggcatgatg
gggatcaagcagttcgatgcggtgatcaatccgccacaggcgatgatcctggccattggc
gcgggcgagaaacgcccgtgggtgatggaggatggcacgcttggcgttgcgacggtgatg
tcggtcaccggcagctttgaccatcgcgccattgatggcgccgatggcgcccaactgatg
acggccttccgcgaactggtggaaaagccactgggccttgcggcctga

DBGET integrated database retrieval system