KEGG   Neurospora tetrasperma: NEUTE1DRAFT128600Help
Entry
NEUTE1DRAFT128600 CDS       T03451                                 

Gene name
NEUTE1DRAFT_128600
Definition
(RefSeq) hypothetical protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
nte  Neurospora tetrasperma
Pathway
nte00350  Tyrosine metabolism
nte00360  Phenylalanine metabolism
nte00380  Tryptophan metabolism
nte01100  Metabolic pathways
nte01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nte00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    NEUTE1DRAFT128600 (NEUTE1DRAFT_128600)
   00360 Phenylalanine metabolism
    NEUTE1DRAFT128600 (NEUTE1DRAFT_128600)
   00380 Tryptophan metabolism
    NEUTE1DRAFT128600 (NEUTE1DRAFT_128600)
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    NEUTE1DRAFT128600 (NEUTE1DRAFT_128600)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nte04147]
    NEUTE1DRAFT128600 (NEUTE1DRAFT_128600)
Enzymes [BR:nte01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     NEUTE1DRAFT128600 (NEUTE1DRAFT_128600)
    4.1.1.105  L-tryptophan decarboxylase
     NEUTE1DRAFT128600 (NEUTE1DRAFT_128600)
Exosome [BR:nte04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NEUTE1DRAFT128600 (NEUTE1DRAFT_128600)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 20825227
NCBI-ProteinID: XP_009849412
JGI: Neute_matA2_128600
UniProt: F8MJE7
Position
Unknown
AA seq 508 aa AA seqDB search
MDSQGFREAAATAIDDIASYYDNLDDRNVVSTVEPGYLRKLLPSEAPVEGEAWTDIHKDI
EGKILPGITHWQHPGFHAFFPCATSFPSILGELYSAALSGACFNWICSPAVTELETIVLD
WLAKILGLPECYLSTGPTRGGGVIQGSASEAVLTAMVAARDKYLRETVPLEQFPEGSEAR
EDAIAHKRSKMVALATTATHSSTKKASIILGVRFHTIAVHADTGYSLTGPVLAKTLAELR
ARGLEPFFMTATMGTTDTCAVDDFAGIVSTLKSDPVHPAGTPGELWVHIDAAYAGSALVL
PSVREQVSISLIENFHSFDMNMHKWLLTNFDASCLFVRDRNWFIQALTINQAVYGNKASE
GGLVTDYREWQIPLGRRFRSLKIWFVLRNYGVKGLQSYISRTLKLGEEFADSLKSRPDLF
EILTGPNFALTVFRVAGKEQGKSDEELNALTKAVCEKINASGRMWVTSTVLDGRFAIRMV
TSVSTTEKEHVDRAWKILVEAAEEVVKA
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggattcccaggggttccgtgaggccgctgctacggccattgatgatattgccagctat
tatgacaaccttgacgaccggaatgtcgtgtctaccgtagaacctggctaccttcggaag
cttctgccatccgaggccccggtcgaaggcgaggcatggaccgatattcacaaagatatt
gagggcaagatcctccccggtatcactcactggcaacaccccggctttcatgccttcttc
ccctgcgccaccagcttcccctccatccttggcgagctctacagcgccgccctctccggc
gcctgcttcaactggatctgcagcccggccgtgaccgagctcgaaacgattgtgctcgac
tggctggccaagatcctcggccttcccgaatgctacctgtccaccggtcccacccgcggc
ggcggcgtcatccaggggtccgcctccgaggccgttctgaccgccatggtcgccgcccgt
gacaagtacctacgcgagaccgtccctctcgagcagttccccgagggctccgaggcgcgc
gaggacgccatcgcccacaagcgtagcaagatggtggcgctcgccacgacagccacccac
tcgtccaccaagaaggcctccatcatcctcggcgtgcggtttcacaccatcgccgtccac
gccgacacgggctactcgctcaccgggccagtgctggccaagacgctcgccgaactgcgc
gcccgtggtctcgagcccttcttcatgaccgccaccatgggaacgaccgacacgtgcgcg
gtcgacgacttcgcaggtatcgtgtcgacactcaagtcggaccccgtgcacccagccggt
acccctggcgagctgtgggtgcacattgacgcagcctacgccggctcggcgctcgttctc
ccctctgtgcgggagcaagtctccatttcgctgatcgagaacttccactcgttcgacatg
aacatgcacaaatggctcctcacaaatttcgacgcctcgtgcctcttcgtgcgtgaccgc
aactggttcatccaagccctcaccatcaaccaggccgtgtacggcaacaaggcgtccgag
ggcgggctggtgacggactaccgcgagtggcagatcccgctgggccgacggttccggtcc
ctcaagatctggttcgtgctgcggaactacggcgtcaagggcctgcagagttatatctca
cgcaccctcaagctgggcgaggagtttgccgactcgctcaagtctaggccggatctattt
gagattttgaccggccctaactttgcgctgactgtgttcagggtcgccggcaaggagcag
ggtaagagcgatgaggagctgaatgcgcttaccaaggctgtgtgcgaaaagatcaacgct
tccggcagaatgtgggtgactagcacggtgctggatggcaggttcgccattcgcatggtg
actagcgtgagtacgactgagaaggagcatgttgaccgggcgtggaagattctggttgag
gcggcggaggaggttgtcaaggcttag

DBGET integrated database retrieval system