KEGG   Neurospora tetrasperma: NEUTE1DRAFT14194Help
Entry
NEUTE1DRAFT14194  CDS       T03451                                 

Gene name
NEUTE1DRAFT_14194
Definition
(RefSeq) hypothetical protein
  KO
K16944  septin 7
Organism
nte  Neurospora tetrasperma
Brite
KEGG Orthology (KO) [BR:nte00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nte04131]
    NEUTE1DRAFT14194 (NEUTE1DRAFT_14194)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:nte04812]
    NEUTE1DRAFT14194 (NEUTE1DRAFT_14194)
   04147 Exosome [BR:nte04147]
    NEUTE1DRAFT14194 (NEUTE1DRAFT_14194)
Membrane trafficking [BR:nte04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    NEUTE1DRAFT14194 (NEUTE1DRAFT_14194)
Cytoskeleton proteins [BR:nte04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     NEUTE1DRAFT14194 (NEUTE1DRAFT_14194)
Exosome [BR:nte04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NEUTE1DRAFT14194 (NEUTE1DRAFT_14194)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 GTP_EFTU ABC_tran AIG1 Roc AAA_16 RsgA_GTPase Ras AAA_22 AAA_29 FtsK_SpoIIIE AAA_24 Dynamin_N Sigma54_activat AAA_7 RNA_helicase Exonuc_VII_L
Motif
Other DBs
NCBI-GeneID: 20826261
NCBI-ProteinID: XP_009848697
JGI: Neute_matA2_14194
UniProt: F8MJC5
Position
Unknown
AA seq 409 aa AA seqDB search
LSDNRNIVRRKLTGYVGFANLPNQWHRKSVRKGFNFNVMVVGESGLGKSTLVNTLFNTSL
YPPKERKGPSLDIVPKTVTIQSISADIEEAGVRLRLTVVDTPGFGDFVNNDESWRPIVDN
IEQRFDAYLDAENKVNRMNIVDNRIHACVFFIQPTGHSLKPLDIEVMKRLHTKVNLIPVI
AKSDTLTDDEIAAFKARILADIKYHKVQIFEGPRYELDDEETIAENNEIMSKVPFAVVGA
TNEITNADGRKVRGRRYPWGVIEVDNEEHCDFVKLRQMLIRTHMEELKEHTNNVLYENYR
TDKLIAMGVSQDPSVFKEVNPAVKQEEERALHEQKLAKMEAEMKMVFQQKVAEKESKLKQ
SEEELYARHREMKEQLERQRLELEEKKSRIESGRPIEKEPTKRKGFSLR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgacaaccgaaacattgtccgaaggaagctgacgggatacgttggtttcgccaac
cttcccaaccaatggcaccgcaagagcgtccgcaagggcttcaacttcaatgtcatggtt
gttggtgaatcgggactcggaaagtcgaccctcgtcaacactctctttaacacttcgctt
taccctcccaaggagcgcaagggacctagcctcgacattgttcccaagactgtcaccatt
cagtctatcagcgccgatattgaagaggctggtgttcgcctccgtttgaccgtcgttgac
actcctggcttcggcgactttgtcaacaacgacgagtcttggcgtcctattgtggacaac
atcgaacagcgcttcgatgcttacttggatgccgaaaacaaggtgaaccgcatgaacatt
gtggacaacaggatccatgcctgtgttttcttcatccagcccaccggtcactcgctcaag
cctcttgatatcgaggtcatgaagcgtctccacaccaaggtcaacttgattcccgtcatc
gccaagtcggatactctcaccgatgacgagattgctgctttcaaggctagaattcttgcg
gatattaagtaccacaaggtgcaaatctttgagggccctcgctacgaactcgacgacgag
gagaccatcgcggagaacaacgagatcatgtccaaggtccccttcgctgttgtcggtgcg
accaacgagatcacaaacgccgatggccgtaaggttcgcggtcgccgttacccttggggt
gtgatcgaggtggacaatgaggagcactgcgactttgtgaagctccgccaaatgctcatc
cgtactcacatggaggagctcaaggagcacaccaacaacgtcctttacgagaactaccgc
acggacaagttgatcgctatgggcgtctctcaagatccaagcgtcttcaaggaggtgaac
ccagccgtcaagcaggaggaagagcgcgccctccacgaacagaagcttgcgaagatggaa
gccgaaatgaagatggtcttccagcaaaaggttgctgaaaaggaatccaagctgaagcag
agcgaagaggagctgtatgctcgtcatagggagatgaaggagcagctggagcgccaacga
ctggagctcgaggagaagaagtcccgaatcgaaagtgggcggccaattgagaaggagccg
acaaagaggaagggattttctctccga

DBGET integrated database retrieval system