KEGG   Neurospora tetrasperma: NEUTE1DRAFT60847Help
Entry
NEUTE1DRAFT60847  CDS       T03451                                 

Gene name
NEUTE1DRAFT_60847
Definition
(RefSeq) hypothetical protein
  KO
K09568  FK506-binding protein 1 [EC:5.2.1.8]
Organism
nte  Neurospora tetrasperma
Brite
KEGG Orthology (KO) [BR:nte00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:nte03110]
    NEUTE1DRAFT60847 (NEUTE1DRAFT_60847)
Enzymes [BR:nte01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     NEUTE1DRAFT60847 (NEUTE1DRAFT_60847)
Chaperones and folding catalysts [BR:nte03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    NEUTE1DRAFT60847 (NEUTE1DRAFT_60847)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-GeneID: 20828833
NCBI-ProteinID: XP_009849664
JGI: Neute_matA2_60847
UniProt: F8MGF7
Position
Unknown
AA seq 102 aa AA seqDB search
MGVNKITHVAGIGPQPEAGQTVIIEYTGWLKDSSQADGKGAHSIGRGDFVTQIGVGRLIR
GWDEAVLEMKVGEKATLDISSDYGYGERGFHGHIPPNADLIL
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtcaacaaaatcactcacgttgcgggtatcgggccacaaccagaagctggccag
accgtgattatcgagtatactggttggctgaaggactcgagccaggccgatggaaaggga
gcccactcgatcggtcgtggggattttgtcacgcaaatcggggttgggagactcatcaga
ggatgggatgaggctgtattggaaatgaaggttggcgagaaggccactttggatatctct
agtgattacggatacggagagcggggttttcacggccacattcctccgaacgcggatttg
attttgtga

DBGET integrated database retrieval system