KEGG   Neurospora tetrasperma: NEUTE1DRAFT64261
Entry
NEUTE1DRAFT64261  CDS       T03451                                 

Gene name
NEUTE1DRAFT_64261
Definition
(RefSeq) c-14 sterol reductase ERG-3
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
nte  Neurospora tetrasperma
Pathway
nte00100  Steroid biosynthesis
nte01100  Metabolic pathways
nte01110  Biosynthesis of secondary metabolites
Module
nte_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:nte00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    NEUTE1DRAFT64261 (NEUTE1DRAFT_64261)
Enzymes [BR:nte01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     NEUTE1DRAFT64261 (NEUTE1DRAFT_64261)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 20829067
NCBI-ProteinID: XP_009851518
JGI: Neute_matA2_64261
UniProt: F8MLY5
Position
Unknown
AA seq 491 aa
MAAGKQNQAAAKKGVAPRQQHYEFGGPIGAFGITFGLPILVHVFNLFCNDISGCPAPSLL
HPKSLDLAQLKREIGWPDNGVFGLFSWSATLWTLAYYALSLVQYRFLPGHHVEGTELSTG
GRLKYKLNAFNSAMCTLAILAAGTIAQGAEFPVWTFISDNFAQIISANILFAFALAIFVY
VRSFEVKPGNKDMRQLAAGGVTGSLIYDFYIGRELNPRITLPLIGQVDIKEFMEMRPGLL
GWIILNCAFIAKQYRLYGYVTDSILFITAIQAFYVFDGIYMEPAVLTTMDITTDGFGFML
SFGDVVWVPFMYSTQTRYLAVHPQQLGAFGLIAVGAVLAAGYSIFRLSNSQKNNFRRNPE
DPSVKHLTYLQTKTGSRLITSGWWGIARHINYLGDWLQSWPYSLPTGIAGYQILSAGSNA
PGAITMLDGREVVQGEARGWGIVFTYFYILYFAILLIHRDLRDDEKCSKKYGEAWEKYKK
LVKWRIVPGIY
NT seq 1476 nt   +upstreamnt  +downstreamnt
atggccgccgggaaacaaaaccaagctgccgcaaagaagggggttgcgccgcgccagcag
cactacgagtttggcggccccatcggcgcctttggcatcacctttggcctccctattctc
gtccacgtcttcaaccttttctgcaacgacatctcgggctgccccgcgccctcgctcctc
caccccaagtctctcgacctcgcccagctcaagcgcgaaatcggctggcctgacaatggc
gtcttcggcctcttctcgtggtccgccacgctgtggactttggcttactacgccctttcg
ctcgttcaataccgctttctccccggccaccacgtcgagggaaccgagctgagcaccggc
ggccggctcaagtacaagctgaacgctttcaactcggccatgtgcaccttggccatcctg
gctgccggcactatcgctcagggcgccgagttccccgtttggactttcatttccgacaac
tttgcccagatcatcagcgccaatatcctcttcgctttcgccctcgccatcttcgtctac
gtccgcagctttgaggtgaagccgggtaacaaggacatgcgccagctagcagcaggcggt
gtcaccggctccctcatctacgatttctacattggtcgcgagctcaatcctcgcatcacc
cttcccctcatcggtcaagtagacattaaggaattcatggaaatgcgccctggtcttctg
ggctggatcattctcaattgcgccttcatcgccaagcaataccgcctttacggctacgtc
accgattcgattctcttcatcaccgccatccaggctttctatgtctttgacggaatctac
atggagccggccgtcttgactacgatggatatcactaccgacggcttcgggttcatgctg
agcttcggagatgtcgtttgggtgcccttcatgtactcgactcagactcgctaccttgcc
gtccatcctcagcagctgggcgctttcggactgattgctgttggtgctgtcctggctgct
ggctatagcatcttccgcctgtccaattcgcagaagaacaacttccgcaggaaccccgag
gatcccagtgttaagcaccttacctacctccagaccaagactggatcgagactcattacc
tcgggatggtggggcatcgctcgccacatcaactatctcggtgactggcttcagagctgg
ccttattctctcccgaccggcattgctggctaccagatcttgagcgccggcagcaatgct
cctggtgcaattaccatgctcgacgggcgcgaagttgtccagggcgaggcgagaggctgg
ggtattgttttcacttacttttacatcttgtactttgccattctcttgatccaccgcgac
ctcagagatgacgagaagtgctccaagaagtatggcgaggcttgggaaaagtacaagaag
cttgtcaagtggagaattgtccctggtatctactag

DBGET integrated database retrieval system