KEGG   Neurospora tetrasperma: NEUTE1DRAFT76302Help
Entry
NEUTE1DRAFT76302  CDS       T03451                                 

Gene name
NEUTE1DRAFT_76302
Definition
(RefSeq) Palmitoyltransferase PFA3
  KO
K20028  palmitoyltransferase ZDHHC2/15/20 [EC:2.3.1.225]
Organism
nte  Neurospora tetrasperma
Brite
KEGG Orthology (KO) [BR:nte00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nte04131]
    NEUTE1DRAFT76302 (NEUTE1DRAFT_76302)
Enzymes [BR:nte01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     NEUTE1DRAFT76302 (NEUTE1DRAFT_76302)
Membrane trafficking [BR:nte04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    NEUTE1DRAFT76302 (NEUTE1DRAFT_76302)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC DUF4064 STELLO
Motif
Other DBs
NCBI-GeneID: 20829879
NCBI-ProteinID: XP_009848011
JGI: Neute_matA2_76302
UniProt: F8MEI2
Position
Unknown
AA seq 597 aa AA seqDB search
MARRWARKLERYCCTCVTYFPLAFVYTMTSWAVYVDVSLSTTPSRVTWLGHSYGFIAVVL
YLLANWCYTYAVFTSPGSTTNEYGYSTLPTQAPPTATSFTVKSNGEFRFCKKCQARKPDR
AHHCSTCRRCVLKMDHHCPWLATCVGLRNHKAFLLFLIYTSLFCWVSFAGSASWVWEEIM
SNTTYVETLMPVNYIMLSVISGIIGIVLSAFCGWHIYLASRGQTTIECLEKTRYLSPLRE
SMQRTYVNQHTPGQGIALPKYGQQLLDIHQNTIPGVTRPEEGEEMRRMTTPSGSSQRNDL
AAQHNPELQAGSRRFTYDEMEHIRARKRYEDYLDEQDSTKLPHAFDLGTPRNLLHLFGTN
AWLWPFPVCTTIGDGWSWEPNPKWIEARDRIAREREEQRQRERQAGWGPADDDDITPVYT
PTWTPPNQQQQPQGGAGRHYLQPSSQPQTQRNSNSSSPSFTPSRRTPSKADRILGRDPNM
YADDEPVIYGKHDVAMSRLSPAGRTLVVEDDVDDDDDDDEDYFQDADRKQEDAEQSALNV
VTNGRWGRPAGASGVGLLAHGRPGGARSPISPISPPAGGFGGSARNGEGRSNDDGVD
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgccgctgggccagaaaactcgagcgctactgctgcacatgcgtcacctacttt
cccctcgccttcgtttacactatgacaagctgggccgtctatgtcgatgtctcgcttagt
acgaccccatctcgcgtcacttggctaggtcactcctatggcttcatcgccgtcgttctc
tacctcctcgccaactggtgctacacatacgctgtcttcacttcgcccgggagcaccacc
aacgagtatggctacagtaccctccctacacaagcgccccctactgccacctccttcacc
gtcaagtccaacggcgaattccgattttgcaaaaagtgccaggcacgaaagcccgaccgc
gctcaccactgctcgacatgccgacgctgcgttctgaaaatggaccaccactgtccgtgg
cttgcaacatgtgttggcctgcgcaatcacaaggcctttttgctgttcctcatctataca
tcacttttttgctgggtcagctttgccggttcggcatcgtgggtgtgggaggagattatg
agcaataccacctacgtcgaaaccctcatgccagtcaactacattatgctttccgtcatc
tctggaattatcggtatcgtcctgtccgctttttgcggatggcatatatacctggcttcc
cgtggacagaccaccattgaatgtttagagaaaacgcgctatctgtctccgctgcgcgaa
tcgatgcaaaggacctacgtcaaccaacatacgcccggccaaggtattgcgctgcctaaa
tatggtcagcaactactggacatccaccaaaacaccattccaggagtcacacgaccagag
gaaggtgaagagatgcgacggatgacgactccttcgggctcatcccaacgcaacgatctt
gccgcccagcacaatcctgaactccaggcaggctcccgccgctttacatacgacgaaatg
gaacatatacgcgcccgtaaacgctacgaagactacttggatgagcaggactcgaccaag
ctgccccacgctttcgatctcgggacaccgcgcaacctgctgcatctctttggtaccaac
gcctggctatggcccttcccggtatgcaccaccatcggcgacggttggagctgggagccg
aacccgaagtggatcgaggcacgcgatcgtatcgctcgggagcgcgaagagcaacggcag
cgggagcgacaagccggatggggcccagccgacgacgacgatattacgcctgtatataca
cctacatggacgccgcccaaccaacaacaacaaccacaaggtggtgcgggtcgtcactac
ctgcagccctcctctcagccacaaacacagcgcaacagtaactccagtagcccgtcattc
accccttcacgacgcacacccagcaaagccgaccgaatcctgggccgcgatcccaacatg
tacgccgatgatgaaccagtaatatatggcaaacacgacgtagccatgagcagactgagt
cccgcaggccgtactctagtagtagaagacgacgttgatgatgatgacgatgacgacgag
gactacttccaagatgctgaccgcaaacaggaggatgcggagcaaagtgccctgaatgtg
gtaacaaacgggcgatggggtcgccctgccggcgcaagcggagtgggattgcttgcgcat
ggacggcctgggggagcgaggagtcccattagtcctataagtcctcctgctgggggattt
ggtgggagcgcgaggaatggggagggaaggtcgaatgatgatggcgtggattga

DBGET integrated database retrieval system