KEGG   Neurospora tetrasperma: NEUTE1DRAFT79833Help
Entry
NEUTE1DRAFT79833  CDS       T03451                                 

Gene name
NEUTE1DRAFT_79833
Definition
(RefSeq) hypothetical protein
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
nte  Neurospora tetrasperma
Brite
KEGG Orthology (KO) [BR:nte00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nte01009]
    NEUTE1DRAFT79833 (NEUTE1DRAFT_79833)
Enzymes [BR:nte01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     NEUTE1DRAFT79833 (NEUTE1DRAFT_79833)
Protein phosphatases and associated proteins [BR:nte01009]
 HAD phosphatases
  Other HAD phosphatases
   NEUTE1DRAFT79833 (NEUTE1DRAFT_79833)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-GeneID: 20830238
NCBI-ProteinID: XP_009849804
JGI: Neute_matA2_79833
UniProt: F8MHC2
Position
Unknown
AA seq 323 aa AA seqDB search
MSPRTDFPPVRACLFDMDGLLLDTEDIYTLCVNELLRKHKKEKFPLPWSIKAQLQGRPGP
AALDIFHNWADLPITREQYKEEYYALQAQKFQFTSALPGVEELLQKLGSTRYWDLKGDAT
TTNGALAQKPHRVHIALATSSHEANFRMKTNHLTELFSVFESHRRVLGDDKRIPQGRGKP
LPDIYLIALKTINDSLPEGEKPITPEECLVFEDSIPGVEAGRRAGMRVVWCPHPMLKQEA
QASLTNGTTEANTEKSGEADSEKPGEVDDGWAEYLPSLIDFPYEKYGIHIPDEAVDQEPS
MKETAKIDEGEVLQAVQTEVVEN
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccccgcaccgatttccctcccgtccgggcctgcctgttcgacatggacggcctt
ctcctcgacaccgaggacatctataccctctgtgtcaacgagcttcttcgaaagcacaag
aaggagaagttccccttgccttggagcatcaaggctcagcttcaaggtcgccccggtccc
gcggcccttgacatattccataactgggccgatttgcccattactcgtgagcagtacaaa
gaggagtattacgctcttcaagctcaaaagtttcagttcacctcggctcttcccggtgtc
gaggagcttctacagaagcttggcagtacccgctactgggatctaaagggggatgctact
accaccaacggcgcactcgcacaaaaacctcatcgcgttcatatcgctcttgctacctct
tctcatgaagcgaactttcgaatgaagaccaaccatctgaccgaactgttctcggtcttt
gagagtcaccgtcgcgttcttggtgacgacaagcgcatcccgcagggccgcggcaagccc
cttcccgatatttacctaatcgccctcaagaccatcaacgattcacttcctgagggcgag
aagcccatcactcccgaggaatgccttgtcttcgaagacagcatccccggcgtcgaggcc
ggtcgtcgtgccggcatgcgcgttgtttggtgcccgcaccctatgctcaagcaagaggct
caagccagcctcactaacggcactaccgaagccaacaccgagaagtccggtgaggcggac
agcgaaaagcctggtgaagttgacgatggttgggcagagtaccttcctagtttaatcgac
tttccgtacgagaagtacggcattcacattcccgatgaggccgttgatcaggagccctca
atgaaggaaaccgccaagattgacgagggcgaagttcttcaggctgtccagaccgaggtc
gtcgagaactga

DBGET integrated database retrieval system