KEGG   Neurospora tetrasperma: NEUTE1DRAFT87025
Entry
NEUTE1DRAFT87025  CDS       T03451                                 

Gene name
NEUTE1DRAFT_87025
Definition
(RefSeq) nitrite reductase
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
nte  Neurospora tetrasperma
Pathway
nte00910  Nitrogen metabolism
nte01100  Metabolic pathways
Module
nte_M00531  Assimilatory nitrate reduction, nitrate => ammonia
nte_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:nte00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    NEUTE1DRAFT87025 (NEUTE1DRAFT_87025)
Enzymes [BR:nte01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     NEUTE1DRAFT87025 (NEUTE1DRAFT_87025)
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Fer2_BFD Pyr_redox Rieske_2 Rieske NIR_SIR_ferr Rubredoxin_C NAD_binding_9 NAD_binding_8 NAD-GH
Other DBs
NCBI-GeneID: 20830983
NCBI-ProteinID: XP_009854037
JGI: Neute_matA2_87025
UniProt: F8MW42
Position
Unknown
AA seq 1169 aa
MASSTSPSPSPESTTPPRKRIVVVGLGMVGIAFIEKLIKLDTQRQYEIVVVGEEPHVAYN
RVGLTSFFSHREVEQLYLNPLEWYKQHLQTSSLTHHLSTTALSLSPATKSLTISPPPSTP
SLTTLPYDHLILATGSRALLPTSTPGHDASGVFVYRTIADLQSLITWSSDTQIKGSTGVV
VGGGLLGLEAAKALMDLQVFGRVVVIERNGWVLSRQVDGEAGALVLEGVRGLGVEVLTRK
RVKEVECDHGEDEGQKEKKRVKGIRFEDGEYLACSTICFAIGIKARDELARQAGITCAER
GGGGIVVDDSLQTSAADVYAIGECASWKGQTFGLIGPGVEMADVLAFNFTQAHLHTPRVF
KRPDLSTKLKLLGVEVASFGDFFADRDGPKELPPKLRRELKKSGGKAEVKALTYKDPFLS
VYKKYIFTSDGKYLLGGMMIGDTTDYVRLVPLVKTHKELDIPPSQLILGAKKSGDDNGDD
DLPDDTQICSCHNVTKADLVAPLKSGECTSLGDLKSCTKAGTGCGGCMPLVTSIFNRTMA
SLGTEVKNNLCPHFPEYSRADLYNIISVKRLRTLPDVMREAGADADSLGCEACKPAIASI
FASLWNDHVMSPAHHGLQDTNDRFMGNIQRNGTFSVVPRVAAGEITPEKLIVIGEVAKEY
NLYTKITGGQRIDMFGARKQDLLNIWKKLVDAGMESGHAYAKSLRTVKSCVGTTWCRYGV
GDSVGMAVRLEERYKGLRGPHKIKGGVSGCTRECAEAGNKDFGLIATEKGFNILICGNGG
TTPKHSVLLAKDVPPTNVIPIIDRFLMFYIRTADKLQRTARWLEALPGGIDYLKEVILED
RLGICASLEAQMQELVDSYFDEWAEALNNPAMQERFKQFANTDEGQPPMEVEIDRGQERP
VMWPREDQGGSAKADFKGLRDKWSSTTWQPVLEASYFQGADDLPNGISASIKRGDTQLAV
WRIKGKYYASQQMCPHKRTFALSDGFVGTDPSPSSCSSTALPPSPPSTPPRSSSPVTSSP
QSPTSSATPATTTSSSCTTNPSGPSSPWISCPFHKRNFSLTSGSCKNDNELSIATFDVEE
RDDGMVYIKLPPVDELDRELGTKKWMVKRGEAGEGQFRELDELNKSKGVEGKKGRRGRKP
GASEAGKEVGKKLVEAVGGGGCGGPGLEW
NT seq 3510 nt   +upstreamnt  +downstreamnt
atggcttcaagtacaagcccaagcccaagtccagaatcaactactcctccgagaaagagg
attgttgtcgtgggattgggcatggttggtattgcttttatcgaaaaactcatcaaactc
gacacccagcgccaatacgaaatcgtcgtcgtcggcgaagaaccacatgtagcgtacaac
cgcgtcggtttgacttccttctttagtcatcgcgaagttgagcagttgtatcttaatcct
ttggaatggtacaaacaacacctccaaacctcctctctaacgcaccacctctccaccacc
gccctctccctttcccccgccaccaaatccctcaccatctccccgcccccctccaccccc
tccctcactaccctcccctacgaccacctgatcctcgccaccggctctcgcgccctcttg
cccacttccacacccggccacgatgcgtccggcgtctttgtctacagaactatcgccgac
ttgcagtccctcataacatggtcatccgacactcaaataaagggatcaacaggcgtggta
gtaggtggcggactactagggttagaagcagccaaagccctaatggatctgcaagtattc
ggacgggtggtggtgatcgaaagaaacggctgggttttatctcggcaggtagacggggaa
gccggggccttggtattggagggggtaagggggttgggggttgaagttctcacgagaaag
agggtcaaggaagtcgagtgtgatcatggagaagacgaaggacagaaagagaagaaaaga
gtaaaggggatacgcttcgaagacggggaatacctggcttgttcgaccatttgtttcgcg
atcgggatcaaagccagggacgaactggcgcgacaagcggggattacgtgcgcagagcgc
ggtggaggaggcatagtggtggatgactccctccagaccagcgcggcagacgtttatgcc
attggcgagtgcgccagctggaaaggccagacgttcgggttgattggtcccggcgtggag
atggcggacgtgttggcgtttaactttacacaagcgcatttacatacgccgcgcgtgttc
aagcggccggacctcagcaccaagctcaagttgctgggtgtggaagtggctagtttcggc
gacttctttgccgaccgcgatgggccgaaggagttaccgcccaaactgaggagggagctg
aagaagagcggcggcaaggcggaagtgaaggcactcacctacaaagaccccttcctctcc
gtctacaaaaagtacatctttacttccgacgggaagtacctactgggaggcatgatgatt
ggcgacacaaccgactacgtccgtctcgtcccgctagtcaaaacccacaaagagctggac
atccctccatcacaactcattctcggcgcgaagaaatccggtgacgacaacggagacgac
gacctcccagacgacacgcaaatctgctcctgccacaacgtcaccaaagccgacctcgtc
gcccctctcaagtccggggaatgcacctccctaggcgacctcaagtcgtgcaccaaagcc
ggcacggggtgcggcgggtgcatgcccctggtgacgtccatcttcaaccgcaccatggct
tcgctggggaccgaagtcaagaataacctctgcccgcacttcccggagtactcgcgcgca
gacttgtacaacatcatctccgtcaagcggctacggactctgccggacgtgatgcgcgaa
gccggcgccgatgctgatagcttggggtgcgaagcgtgcaagccagccattgcttccatt
tttgcttcgctgtggaatgatcatgttatgagtcctgctcatcatggcctgcaggatacg
aatgatcggtttatggggaacatccagcgcaacggaaccttttccgtcgttccgcgcgtt
gctgcgggagaaattacgccggagaagttgattgttatcggggaggtggccaaggagtat
aacctctacactaagattacgggcgggcagagaattgatatgtttggcgcacggaagcag
gatttgttgaacatatggaagaagttggtggatgcgggcatggagagcgggcatgcgtac
gcgaagagtttgcggacggtcaagagctgtgtcgggacaacgtggtgtaggtatggagtg
ggtgatagcgtggggatggcggtcaggttggaggagaggtataaggggttgagggggccg
cacaagatcaagggaggagtgtcggggtgtacgagggagtgtgcagaggcggggaacaag
gacttcggtctcatagccaccgaaaaaggtttcaacattctcatctgcggcaacggcggc
accacgcccaagcactccgttcttctcgccaaagacgtccccccgaccaacgtcatcccc
atcattgaccggttcctcatgttctacatccgtaccgccgacaagctccaacgtaccgct
cgctggcttgaggcccttcccggtggcatcgactacctgaaggaagtcatcctcgaagac
cgcctcggtatctgtgcctcactagaagcccagatgcaagagctggtagacagttacttt
gacgagtgggccgaagctctcaacaacccagcgatgcaagagcgattcaagcagttcgcc
aacaccgacgagggccaaccacccatggaagtcgaaatcgaccgcgggcaagaaagaccc
gtgatgtggccccgcgaagaccaaggcggttcagccaaggcggatttcaagggcttgcga
gacaagtggtcatcaaccacctggcaacccgttctcgaagcatcctacttccagggcgca
gacgacctccccaacgggatatccgccagcatcaagcgcggcgacacgcaactggccgtc
tggcgcatcaaagggaagtactatgcctctcagcagatgtgtcctcacaagcgcaccttt
gctttgtctgacggttttgttggcaccgatccgtcgccgtcttcttgttcttctaccgcc
ctgccgccatcaccacctagtactcctccccggtcttcatcccctgtgacatcctcacct
cagtctcccacctcctctgccacaccggcaaccacaacctcctcatcttgcactaccaac
ccttccggtccttccagcccttggatctcctgccccttccataagcgaaacttctcgctc
acgtcggggtcatgcaagaacgacaacgagctctctattgccacatttgatgtggaagaa
agagacgacgggatggtgtatattaagctgccgcctgttgatgagctggacagggaattg
gggacgaagaagtggatggtgaaaaggggtgaggccggtgaagggcaattcagggagttg
gacgagttgaacaagagtaagggggtagaggggaagaaggggaggagggggaggaagccg
ggtgctagcgaggctgggaaggaggttggcaagaagttggttgaggcggttgggggaggg
ggctgtggtgggcctgggttggagtggtga

DBGET integrated database retrieval system