KEGG   Natranaerobius thermophilus: Nther_0102
Entry
Nther_0102        CDS       T00761                                 
Name
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase
  KO
K00362  nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Organism
nth  Natranaerobius thermophilus
Pathway
nth00910  Nitrogen metabolism
nth01100  Metabolic pathways
nth01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nth00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Nther_0102
Enzymes [BR:nth01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     Nther_0102
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Rubredoxin_C Pyr_redox_3 DAO NAD_binding_8 AlaDh_PNT_C HI0933_like NAD_binding_9 TrkA_N Thi4 NAD_binding_7 GIDA HcgC ApbA FAD_binding_3 3HCDH_N
Other DBs
NCBI-ProteinID: ACB83701
UniProt: B2A3S5
Position
118252..119451
AA seq 399 aa
MHYVIVGSGVSGITAAKNLRNLKPEAKITILGDEPHYCYNRPRLIELLGKEVDIENIFFY
PPDWYCQQGIDIYLNVTVKEIHSKKQLVITDCGQEISYDKLLLANGSTPNLPPVPGAENR
GVFTIRTIDEVRQIQRRALTSSQSIVIGGGLLGLETAFSLTKLKQEVTVIDRNSWLLKRQ
IDQKGSELLQEILKSYGISVVLEGNTESIEPPKNSVGDSKDLNVNLKDGRKIPGQIVIFS
AGVRPNISLAEKAGISVNKGIVVDEHLKTSDPNIYASGDVAEFQDKSYGIIPAALEQGKL
AAVNMASEEGQNYEGTIPSTSLKIAGIDLISLGEIYPQEDDQVVTKIDSSNKIFKKAIFR
ENCLKGAILLGDKTELPLIHKNLRAQQPFRDPELIFENY
NT seq 1200 nt   +upstreamnt  +downstreamnt
ttgcattacgtaatagtaggtagtggtgtttcaggaattacggcagctaaaaatctgaga
aatttaaaacctgaggccaaaattactattcttggagatgagccacattactgttataat
cgacctagattaatagaacttttgggaaaagaggttgacatcgaaaatattttcttttat
cctcctgattggtattgtcaacagggaattgatatttatctcaatgtaacagtgaaagaa
attcatagtaaaaaacagctagttattaccgattgtggtcaggaaatttcttatgataaa
ttattgcttgccaatggaagtaccccgaatcttccacctgtcccaggggcagaaaatcgt
ggtgtgttcactattagaaccattgatgaggttaggcaaatacaaagaagagctcttaca
agtagtcaaagtatcgttattggtgggggcttattgggattagaaacggcttttagttta
actaaattaaagcaagaagttactgtgattgataggaattcgtggcttcttaaaaggcaa
attgatcaaaaaggtagtgaacttctgcaagaaattttaaagtcatacgggatttcagta
gttttagaagggaatactgaaagtattgaaccgccaaaaaattctgtaggagattccaaa
gatttaaatgttaatttgaaagatggtagaaaaataccaggacagatagttattttttcc
gcaggggtacgccctaatatatctctagctgaaaaggctggaatttcagtcaataaagga
attgtagtagacgaacatttaaagacaagtgatccaaatatttacgcatcaggagatgta
gcagaattccaagataaaagttatggaattattccagctgccttagaacaaggcaaatta
gcagcagtaaacatggccagtgaagagggacaaaattacgaagggactattccttcgact
tccttaaaaattgcaggaatagatctgatctctctcggggaaatttatcctcaagaagac
gatcaggtggtgaccaagatagactccagtaataaaatttttaaaaaagctatctttaga
gaaaattgtctaaagggagccattttattaggagataaaacagaacttccgctaattcac
aaaaatttgagagcacaacaaccatttcgagatccagagttaatttttgaaaactattaa

DBGET integrated database retrieval system