KEGG   Natranaerobius thermophilus: Nther_0765
Entry
Nther_0765        CDS       T00761                                 

Definition
(GenBank) aldehyde oxidase and xanthine dehydrogenase molybdopterin binding
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
nth  Natranaerobius thermophilus
Pathway
nth00230  Purine metabolism
nth01100  Metabolic pathways
nth01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nth00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Nther_0765
Enzymes [BR:nth01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     Nther_0765
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C DUF2110
Other DBs
NCBI-ProteinID: ACB84352
UniProt: B2A7Q0
Position
791883..794135
AA seq 750 aa
MQIIGSSYPTHDAKGKATGQTAYAGDMQLAGMLHAAVLFSPIPHGYVKSIDDSKALALPG
VVKVLHCFNTTQKEFSRYRTFVGQPVPDQERVFNNHVRFVGDRVAAVIAETEEIARKAVE
LIEVTYEELPYSLSPEQTLNGSIDNIHKDGAVYGDLHKEVGDESKVDPSAIEITTSNKLD
RLNHLTMETHSCVANYDHGLDELTIWSPNQSVHGLRTVVGDLFEIPYHKIRVIKTTMGGS
FGAKQEWVLEPVAACCALSVGKPVKLVYNRAESMVSVYGRGAVESKITSKITKDGKLQSF
TTDITLDAGAYLGNSYVYINTMLGKFFRCYKYPYVDFTARTTCTNTPVSGGFRGWSGPEA
TLMIEHNLNVAAKRLNIDPVELRLKNVALPGDKDIYIDRDLGEIRLKESLELGREKFNWE
LRKKEVSEFNSKNNRYKRGIGVACGGHVNGFTPKRGEFATVDMRMTEDGSIQANVTLHDH
GCGTVTTFQMIVAEELGIPLDMVSVKEGDTFVSPYDYGCYSSRTVYVLGRAAQECAKEIK
RVLGKNIAELHNIPLEDIEVVNGYVRSKKDEEINYTYAEASVKSLFELGKEVVATYQHKD
DTNPSVTAAHFALVEVDTYTGMTKTLDYLAVHDIGKALNREMCIAQIEGSVTMGMGAAIS
EHLTVSEQGQSTNSMKDYHVVNCYDAPNVRVELIEDGGTDGPYGAKSIGEIAHIPVTATI
VGAINDALSTEICEIPINPDKIAKLMSGRA
NT seq 2253 nt   +upstreamnt  +downstreamnt
atgcaaataataggttcttcttacccaactcatgatgcaaagggtaaagctactggacag
actgcctatgctggtgatatgcaactagcaggaatgttacatgctgctgtgttgtttagt
ccaattcctcatggatacgttaagtcaattgatgactcaaaagcattggcattaccaggg
gttgttaaagtattacattgttttaatacaacccaaaaggagttctctagatatcgaact
tttgttggacaacctgttccagatcaagaaagagtttttaataatcatgttcgttttgta
ggggacagagtagctgcagttattgctgaaacagaagaaattgctcgtaaagctgtggaa
cttattgaagtaacttatgaagaattaccatattcattatcaccagagcaaacgttaaat
ggttcaatagataatatccataaagacggtgctgtctatggtgatcttcataaagaagtt
ggggacgaaagtaaagtggatccttcagcaattgaaattactactagcaataagttagat
aggctcaaccatctcactatggaaactcacagttgtgtagcaaattatgatcatgggtta
gatgagttgactatatggagtccaaaccaaagtgtccatggcttaagaactgtagttggt
gatttgtttgaaataccttatcataagataagagtaattaaaactaccatgggtggttcc
tttggtgcaaaacaagaatgggtattagaacctgtggctgcgtgttgtgcactcagtgtt
ggaaaaccagttaaattggtatataaccgggctgagagtatggtatcagtatacggtaga
ggagccgttgaatctaagattacatcaaaaataacaaaagacggtaagctacagagcttt
acaacggatataactttagatgctggagcttacttaggaaattcatatgtttatattaat
acaatgctcggtaaattcttccgttgctataaatatccttatgtagattttactgctaga
actacatgtactaatacacctgtatctggagggtttagaggatggtcaggaccagaggct
acattaatgattgaacataacttaaatgtagctgctaaaagacttaatattgatcctgtt
gaattgagattaaaaaatgttgctttaccaggagacaaggatatttacatagatcgtgat
cttggagaaattcgccttaaagaatccttagaattaggtagagaaaagtttaactgggaa
ttaagaaagaaagaagtatctgaatttaatagcaaaaacaatcgttataaacgtggtata
ggtgtagcttgcggtggacatgtgaacggatttacaccaaaaagaggagaatttgcaaca
gtggatatgagaatgacggaagatggaagtattcaagcaaacgtaactttacatgaccat
ggatgtggtaccgtaacaactttccaaatgattgttgctgaagaattaggcattcctctt
gatatggtttcagtgaaagaaggagatactttcgtatcaccatatgattatggatgttat
tcaagtagaacagtttatgtattaggacgagcagcacaagagtgtgctaaagaaataaaa
agagttttagggaaaaatatagctgagttacacaatattccactagaagatatagaggtt
gtcaatgggtatgttcgctccaaaaaagatgaggaaattaactatacttatgctgaggca
tctgttaagagtttatttgagctaggaaaagaagttgttgcaacttatcaacataaagat
gataccaatcctagtgtgacggctgctcacttcgcacttgtggaagtagacacatataca
ggcatgacaaaaactttagattatttagcagtacatgacataggaaaagctcttaatcgt
gaaatgtgtatagcccaaattgaaggttcggttactatgggaatgggtgctgccatatct
gaacacttaactgtttctgaacaggggcaaagtactaatagtatgaaagattatcatgta
gttaattgttatgatgcaccaaatgtaagagtagaacttattgaagatggtggaacagac
ggtccatatggagcaaaatcaataggtgaaatagcacatataccagtaacagcaacaatc
gttggtgcaataaatgatgcattatcaactgaaatttgtgaaattccaattaatccagat
aaaattgctaaacttatgagtgggagggcttaa

DBGET integrated database retrieval system