KEGG   Natranaerobius thermophilus: Nther_1169
Entry
Nther_1169        CDS       T00761                                 

Definition
(GenBank) D-ornithine aminomutase S component
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
nth  Natranaerobius thermophilus
Pathway
nth00472  D-Arginine and D-ornithine metabolism
nth01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nth00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Nther_1169
Enzymes [BR:nth01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     Nther_1169
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A
Other DBs
NCBI-ProteinID: ACB84752
UniProt: B2A1L2
Position
1237723..1238076
AA seq 117 aa
MSDFESRRQHLKEMSEKELEQRFWELADKAVDPMVDLAQNHTSPSIERSVLLRMGFDSME
SKAIVDKCVQKELLSKGAGHVVLKVARDQGIEIKEAGRALADGKHWDRAVELFGGGK
NT seq 354 nt   +upstreamnt  +downstreamnt
atgtctgactttgaaagtagaagacagcatttgaaagaaatgtcagaaaaagaactagaa
caacgattttgggaactagctgataaagcagtagaccccatggtcgatttagctcaaaat
catacttcaccatctatagagcgttcagtgttgctaaggatgggctttgatagtatggaa
tcaaaagctattgtagataaatgtgttcaaaaagagctactctccaaaggagccgggcat
gttgtgcttaaagtagcccgtgatcaaggaattgaaattaaagaagcgggaagagccctg
gctgatggtaaacactgggatagagcagtagagctgtttggaggtggtaagtaa

DBGET integrated database retrieval system