KEGG   Natranaerobius thermophilus: Nther_1170
Entry
Nther_1170        CDS       T00761                                 

Definition
(GenBank) D-Lysine 56-aminomutase alpha subunit
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
nth  Natranaerobius thermophilus
Pathway
nth00472  D-Arginine and D-ornithine metabolism
nth01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nth00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Nther_1170
Enzymes [BR:nth01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     Nther_1170
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding MM_CoA_mutase
Other DBs
NCBI-ProteinID: ACB84753
UniProt: B2A1L3
Position
1238076..1240313
AA seq 745 aa
MADNNNQNQKKQENLSTDEKLLIEDILHDLDKYRPKRKGWAWREEQGPRQVGPFNYKEVS
KSLKNSVPLPAARSFQEIDPQPDCVITSEIASGRFEDDIRRMRMAAWHGADHMMVIRTAG
QSHFDGLIEGTPEGVGGIPISRKQLRATRKGLDLIEEEVGRPLNLHSYVSGVSGPEIALL
FAEEGVNGAHQDPQYNVLYRNVNMVRSFVDAAVAKNLMKSVDMLQIDGAHNANATAREAW
KVMPELMVQHAINTAYSRRIGMPDELISLSSVPPTAPPAPALTYDLPYAVALRELFPKNN
IRAQMNTKYIESDTREATVTHVLNLLISRLTRAEIQSTITPDEGRNVPWHHFSVQAVDTA
KQALLGMDGLKDLVEIKRDGIVGERVRELKERAVLFFEEILETGGYFKAVEEGYFVDSGF
YPERNGDGIQRDIDGGVGANTIVKRDEDYMAPVCEHFGYNNLPQEWDSPCEPVDGCTLCD
HDKIAYIDELDDEDNVEKRLEKTEDYRKAEKKLIPEVEWAADRIACLTMFLPVSERVAEY
AALEMVGKMGWEDAEVIHKYSMQPAEGTYVEVKGRVPHEINPSELDIPEPEELLPEDEIR
DYVSENGMKVVAATVGEDEHSVGMREIIDIKHGGIEAFGIKTDYLGTSVPVEKVVDAAVE
IDADAILISTIITHGDVHRENMKKLHQLCVEKGMRDKVILIGGGTQVNDDIAKESGLDAG
FGRGTKGINVASYLVKQMKEDADSN
NT seq 2238 nt   +upstreamnt  +downstreamnt
atggcagataataacaatcaaaaccaaaagaagcaagaaaacttatctactgatgaaaaa
ctcttaattgaagatattttacatgatcttgataagtatcgccctaaaagaaaaggttgg
gcctggagagaagagcaaggccctaggcaagtgggaccctttaattataaagaagtatcc
aaatcacttaaaaatagtgtacctctaccagcagctagaagttttcaagagattgatcct
caaccggattgtgtcataacatctgaaattgcttctggtagatttgaagatgatattcgt
cggatgagaatggctgcctggcatggtgcagatcatatgatggtgattaggacagccggt
cagagtcacttcgatggtttgattgagggaacacctgaaggagtgggtggtatccctatc
tcaagaaaacaattgagagctactcgcaaagggctggatttgattgaagaggaagtgggg
cgtcccctcaatcttcactcatatgttagtggagtatctggaccagaaatagctctgcta
tttgcagaagaaggtgtaaacggtgctcatcaggacccccaatacaatgttctttacaga
aatgttaatatggttcgttcctttgtcgatgcggcagttgctaaaaacttgatgaaatca
gtggatatgctacagatagacggtgctcacaatgccaacgctacagcccgagaagcatgg
aaagttatgcctgaactaatggtacaacatgctattaacacagcatattccaggcgaatc
ggaatgcctgatgaattgatttcactaagtagtgtgccgcctactgcaccgccagcacct
gcgttaacttacgatttaccctatgcggtagctttgagagagttgttccctaagaataat
attagggctcaaatgaacactaaatatattgaatcagacactagagaagcaacagtcact
catgttctgaacctgcttatcagtcgattgactagggcagaaattcagagtactattacg
ccagatgaaggtaggaatgtgccatggcatcatttcagtgtgcaagctgttgacactgca
aaacaagccctgttgggaatggatggcttaaaagacttggtagaaattaagcgcgatggc
attgtaggagaaagagtacgtgaactaaaagaacgagctgtactcttctttgaagaaatt
ctggaaacgggtggttatttcaaagctgttgaagaaggctattttgttgactccggtttt
tatcctgaacgcaatggtgacggtattcaaagagatatcgacggcggagtgggtgccaat
accatagtaaagagagacgaagactacatggcacctgtctgtgagcactttggatacaat
aaccttcctcaagaatgggattcaccatgtgagccagttgatggatgtaccctatgtgac
catgataaaattgcttatattgatgaattagatgatgaagacaacgtagaaaagagatta
gagaaaactgaagattaccgtaaagctgagaaaaaactgataccagaagttgaatgggca
gcagatagaattgcatgcctaacaatgttcctacctgtttctgagagagttgcagaatac
gcagcactagaaatggtaggtaaaatgggttgggaagatgcagaagtgatccacaaatac
agtatgcagccggctgaaggaacttatgttgaagtcaaaggtcgtgtacctcatgaaatc
aatccatctgaactagatatacctgaaccggaagaactgcttcctgaagacgagattcgg
gattatgtatcagaaaacggcatgaaagtagtagctgctacagtaggagaagatgagcac
tccgttggtatgagagaaatcattgatatcaaacacggtggaatcgaagctttcggtatc
aagacagactatctgggtacctcagtacctgtagaaaaagtagttgatgctgcagtagag
attgatgctgatgccatcttgatcagtacaattattacacatggtgatgttcatagagaa
aatatgaaaaagttacatcagctttgtgtggaaaaaggaatgcgagataaggtgatcttg
ataggtggaggaacccaggtgaatgatgacattgcaaaagaatccggacttgatgctgga
tttggaagaggtacaaaaggaattaatgtggcaagctatcttgtaaaacaaatgaaagaa
gatgctgactccaattag

DBGET integrated database retrieval system