KEGG   Natranaerobius thermophilus: Nther_1605Help
Entry
Nther_1605        CDS       T00761                                 

Definition
(GenBank) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
nth  Natranaerobius thermophilus
Pathway
nth00230  Purine metabolism
nth00240  Pyrimidine metabolism
nth01100  Metabolic pathways
nth01110  Biosynthesis of secondary metabolites
nth01130  Biosynthesis of antibiotics
Module
nth_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
nth_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
nth_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:nth00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Nther_1605
   00240 Pyrimidine metabolism
    Nther_1605
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nth04131]
    Nther_1605
Enzymes [BR:nth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     Nther_1605
Membrane trafficking [BR:nth04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    Nther_1605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK PSI_PsaJ
Motif
Other DBs
NCBI-ProteinID: ACB85179
UniProt: B2A4K4
Position
complement(1682177..1682596)
Genome map
AA seq 139 aa AA seqDB search
MSSQNEQTFVMVKPDGVERGLVGEIISRLENKRLNLRKITMLEVSKELAQTHYQEHRDKP
FFNDLINYITSGPVVAMVWEGDNVIEVVRKLIGDTDPKKAAPGTIRGDLALDITYNLVHG
SDSEDTAKREINLFFRPTN
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcacaaaatgaacaaacctttgttatggttaaacccgatggggtagagagggga
ttagtcggagagataatttctcgactagagaataagagattgaacttaaggaagataacc
atgttagaagtctctaaagagttagcccaaacccattatcaagaacatagggacaaaccc
ttttttaacgatttaatcaattacataacaagtggaccagtggttgctatggtatgggag
ggagataatgtcattgaggttgttcgtaagttgataggggatacggaccctaaaaaagct
gcaccaggtaccattagaggtgatttagctttagatataacttataacttagttcacggg
tctgatagtgaagatactgcaaaaagagaaattaatttattttttcgaccgacgaactaa

DBGET integrated database retrieval system