KEGG   Natranaerobius thermophilus: Nther_2017Help
Entry
Nther_2017        CDS       T00761                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nth  Natranaerobius thermophilus
Pathway
nth00010  Glycolysis / Gluconeogenesis
nth00051  Fructose and mannose metabolism
nth01100  Metabolic pathways
nth01110  Biosynthesis of secondary metabolites
nth01120  Microbial metabolism in diverse environments
nth01130  Biosynthesis of antibiotics
nth01200  Carbon metabolism
nth01230  Biosynthesis of amino acids
Module
nth_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nth_M00002  Glycolysis, core module involving three-carbon compounds
nth_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nther_2017
   00051 Fructose and mannose metabolism
    Nther_2017
   00562 Inositol phosphate metabolism
    Nther_2017
Enzymes [BR:nth01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Nther_2017
Exosome [BR:nth04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Nther_2017
  Exosomal proteins of bladder cancer cells
   Nther_2017
  Exosomal proteins of melanoma cells
   Nther_2017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF1450 GTP_EFTU AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ACB85584
UniProt: B2A6Z3
Position
complement(2127291..2128061)
Genome map
AA seq 256 aa AA seqDB search
MARTIIAGNWKMNHGPRETREFVAGMKEKYQTPPAVETVICPPFVSISDLVNESPEWLKT
GAQNVYFEESGAFTGEVSPKMLAELGVEYVIIGHSERRNIFAESDEEVNKKVRIALKYGI
KPIICVGESDAQRNEGKTLEVVENQVKSALSEVVSDTLQNVVFAYEPVWAIGSGKAATGE
DAEQVCKHIRSVISELNSSVADDIPVLYGGSVKPENLEEFMDQDNINGALVGGKSLVAET
YCQLLEVARRFPGDEG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtggccaggactattattgcagggaactggaagatgaaccatggtcctagagaaaccagg
gagtttgtggctggtatgaaagaaaaataccaaaccccaccggcagtagaaaccgtgatt
tgccctccttttgtatcaatatctgatctggtaaatgagagccctgaatggcttaaaacc
ggagctcaaaatgtttatttcgaagagagtggtgcttttacaggagaagtttctccaaaa
atgttggcagaattgggagtagaatatgtaatcattgggcattcagagagaagaaatatc
tttgcagagtctgatgaggaagtgaataaaaaagttaggattgcgctaaaatatggtatt
aaaccaattatttgtgttggagaaagcgatgctcagagaaatgaaggtaaaaccttagaa
gtagtggaaaatcaagttaaatcagctctgtcagaagtagtttctgataccttgcaaaat
gtagtatttgcctatgaaccagtatgggcaataggatcaggtaaagcagctacaggcgag
gatgccgagcaagtttgtaagcatattagatcagtgataagtgaacttaactcaagcgtg
gcagatgatatacctgtgttatacgggggtagtgtaaaaccagagaatttagaagaattt
atggaccaggacaatattaatggggcccttgtaggagggaaaagcttagtagcagaaacc
tactgtcaattactggaggtagctaggaggttcccaggtgatgaaggataa

DBGET integrated database retrieval system