KEGG   Natranaerobius thermophilus: Nther_2347Help
Entry
Nther_2347        CDS       T00761                                 

Definition
(GenBank) phosphate butyryltransferase
  KO
K00634  phosphate butyryltransferase [EC:2.3.1.19]
Organism
nth  Natranaerobius thermophilus
Pathway
nth00650  Butanoate metabolism
nth01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Nther_2347
Enzymes [BR:nth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.19  phosphate butyryltransferase
     Nther_2347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB EIIA-man
Motif
Other DBs
NCBI-ProteinID: ACB85912
UniProt: B2A8M9
Position
complement(2497363..2498277)
Genome map
AA seq 304 aa AA seqDB search
MYKDFSELLASARKMNPVKLSVAAAEDEHVLEAVKQAIKDNLNLEFSLVGDGEKIEKLRQ
KMGMDQLQAISVIDAKNPRHAAELAVKEVSQGDANYLMKGLVSTKDFLKEVLHQEYGLRT
GRTLSHIGAFEIETYPRVFFMTDGGINPNPALEDKEVIIKNSVEFVRALGIKEPKVAVLA
AVETVNPKMEATIDGANLAKMQERSQIKGAWIDGPLALDNAIDENAAKHKGITSPVAGKA
DILLVPDIESGNLLGKSITFLGGGTMAGMVVGAQVPIVLTSRADSVRSKMTSMALGALAS
QGNA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaggatttttcagaattgctggctagtgccagaaaaatgaatcctgttaaattg
agtgtggctgcagccgaagatgaacatgttttagaagcggttaaacaagccattaaggat
aatttaaatttagagttttccctggtgggtgatggagaaaagattgaaaaattacgccaa
aagatggggatggatcagcttcaggctatttcagttatagatgccaaaaatccaagacat
gcagcggagttagctgtaaaagaggtgtctcaaggagatgccaactacttaatgaaaggt
ttagtatcaacaaaagacttcttaaaggaggttctgcaccaagaatatggtctgagaacc
ggtagaactttaagtcatataggtgcttttgaaattgaaacttatccccgggtctttttc
atgactgatggtggtattaaccccaaccccgccttagaggataaagaagtgattattaag
aattctgtggaatttgtcagagcattggggataaaagaacctaaagttgcagtcctggca
gctgttgaaacagtaaatccgaaaatggaagctaccattgatggtgccaatcttgcaaaa
atgcaggaaagaagccagattaaaggtgcctggatagatggtcctttggcactggacaat
gccattgatgaaaatgcagccaaacacaaagggattactagtcctgttgccggaaaagcc
gatattttactggttcctgatatagagagtggtaatttattaggcaaatctatcaccttt
ttgggcggtggcaccatggcaggtatggttgttggtgcccaggtgcccattgttttgacc
tccagggctgacagtgtcagaagtaaaatgacatctatggcactaggggctcttgccagc
caggggaatgcataa

DBGET integrated database retrieval system