KEGG   Neokomagataea tanensis: D5366_00090Help
Entry
D5366_00090       CDS       T06079                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ntn  Neokomagataea tanensis
Pathway
ntn00450  Selenocompound metabolism
ntn00970  Aminoacyl-tRNA biosynthesis
ntn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ntn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    D5366_00090
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    D5366_00090
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ntn01007]
    D5366_00090
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ntn03016]
    D5366_00090
Enzymes [BR:ntn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     D5366_00090
Amino acid related enzymes [BR:ntn01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   D5366_00090
Transfer RNA biogenesis [BR:ntn03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    D5366_00090
 Prokaryotic type
   Other AARSs
    D5366_00090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 DRIM
Motif
Other DBs
NCBI-ProteinID: QDH25714
UniProt: A0A4Y6V8N9
Position
complement(23877..25421)
Genome map
AA seq 514 aa AA seqDB search
MTRRFTVTTPIFYVNGAPHIGHAYTSIAADVLARFHRLNGVDVLFVSGTDEHGQKVAQTA
EAKGMDAQSYADAVSQSFRQMQEDMAVSADLFVRTTSDAHKKAATALWERVAENGHIYLG
AYEGWYSTRDEAFIGEDELVKKPDGSFVAPSGAPVERVKEPSYFFRLSDFEDRLLKLYEE
QPDFIGPHGPKREIVSFVKQGLRDLSVSRTSFDWGVPVPGDPEHVMYVWFDALANYLTAT
GFPDEQAERAGHWPADLHIVGKEIARFHCVYWPAFLMAAGLPLPKRIFAHGWWTVEGEKM
SKSLGNALDPKMLADEFGLDALRFFLMREVPFGGDSNFSRRSMITRTNVELANDLGNLCQ
RSLSQIARNLDGILPQIGARTEDDAAILAVAEALPGIVSEHMERLALNDALEEIWKLIRA
ANSYIDRQAPWALKKTDTERMADVLRVLVDIIRTIATLLQPFMPTTMALMLTQLGVEESE
RDLAALKSPLPAGRILPKPQGLFPRYVEAESKDA
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgacgcggcgctttacggtaacaactccaattttttacgttaatggtgcgccgcacatt
gggcatgcctacacttctattgcggctgatgttctggcgcgttttcaccgtttaaacggt
gttgatgttctatttgtcagcggtacggatgagcatggtcagaaagtagcgcaaacggct
gaagcaaagggcatggatgcccagtcttacgccgatgctgtttctcagtcattccgtcag
atgcaggaagacatggctgtttctgcagatttgttcgtgcggacaacctccgatgcccat
aaaaaagcggcgactgctctgtgggagcgcgttgcggaaaatggccatatctatcttggt
gcttatgaggggtggtattcgacccgcgatgaagcttttatcggcgaagatgagctagtt
aaaaaaccagacggctcctttgttgccccatctggtgcgccggttgagcgcgtgaaggag
ccatcttacttcttccgcctgtctgattttgaagatcgtctgctgaagttatatgaagag
cagcctgattttatcggtcctcatgggccgaaacgcgaaattgtaagtttcgtaaagcaa
gggctgcgcgatttatcggtttctcgtacgagcttcgactggggtgtgcctgtcccgggt
gatccagagcatgtcatgtatgtgtggtttgatgctctggccaactatctaacggcgact
ggtttcccggacgagcaagctgagcgggcagggcactggcccgctgatctgcacattgtc
ggtaaagaaatagcacgtttccattgcgtctactggcctgctttccttatggcggctggc
ttgccgctccctaagcgcattttcgcgcatggttggtggacggttgaaggcgagaagatg
agcaagtctctcggcaatgccttagaccccaaaatgctggctgatgagtttgggctggat
gctttacgtttctttttgatgcgagaagtacctttcgggggtgattctaattttagccgt
cgttcgatgatcacgcggacgaatgttgaactagcaaatgatttaggaaatctttgccag
cggagtttgagccaaattgcgcgcaacctagatggcattttgccacaaatcggagcgcga
accgaagacgacgcagccattttggctgtggcggaagcgttgccgggcatcgtgtcagag
catatggagcgcctggcactaaatgacgcgctagaagaaatttggaagcttatccgcgcg
gcaaactcctatatcgaccgtcaagcaccgtgggcgctgaagaaaaccgacaccgagcgt
atggcggatgtcttacgtgttctggttgatatcatcaggacaattgcaacgctgcttcag
ccgttcatgccgacaaccatggctcttatgttgacgcagttaggcgttgaagagagtgaa
cgcgacttggccgcgttgaagtcacctctgccagcagggcgcattttgcctaaaccgcaa
ggcttgttcccgcgttacgttgaggcagaaagcaaggacgcctaa

DBGET integrated database retrieval system