KEGG   Neokomagataea tanensis: D5366_01255Help
Entry
D5366_01255       CDS       T06079                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
ntn  Neokomagataea tanensis
Pathway
ntn00030  Pentose phosphate pathway
ntn00480  Glutathione metabolism
ntn01100  Metabolic pathways
ntn01110  Biosynthesis of secondary metabolites
ntn01120  Microbial metabolism in diverse environments
ntn01130  Biosynthesis of antibiotics
ntn01200  Carbon metabolism
Module
ntn_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
ntn_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:ntn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    D5366_01255 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    D5366_01255 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ntn04147]
    D5366_01255 (zwf)
Enzymes [BR:ntn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     D5366_01255 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     D5366_01255 (zwf)
Exosome [BR:ntn04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   D5366_01255 (zwf)
  Exosomal proteins of colorectal cancer cells
   D5366_01255 (zwf)
  Exosomal proteins of bladder cancer cells
   D5366_01255 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: QDH24114
UniProt: A0A4Y6V431
Position
256802..258265
Genome map
AA seq 487 aa AA seqDB search
MESVQQVEPFDYIIFGATGDLTMRKLLPALYNKLRLGQVPADARIIGTARTTLDRDAYIA
RARDALQHFIPAKFLFPNLLEQFLGMISYVTLDGTSADSNWGELAAELSSSPASRIRVFY
FATAPQLYEAICANLHAKEILTPESRVVLEKPIGTSLETADAINEGVGKFLPEKQIYRID
HYLGKETVQNVLALRFANPLLNAIWSAEHIKSVQITAAEVVGVEGRASYYDTSGALRDMI
QNHLLQVLCLVAMEQPETLEADCVRNAKLAVLKALRPIKEDQVANETVRAQYTKGAVDDH
AVPGYLEELGQDSNTETYAAVRTWVDTPRWKDVPFYIRTAKRSKRKVSEIVIQFRETAQS
LFGAVPGNRLVIRVQPNEGVELNLNVKNPILDEYQLETVKLDAPIKVEGGPFPDSYERLL
LDAVRGNPILFIRRDEVDAAWVWAESILNAWADKKAPMHSYAAGSYGPDAAKALLAEHGD
RWHEDMV
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggaatccgttcagcaggtcgagccattcgactacatcatctttggtgccactggcgac
ctgacaatgcgcaagcttttgcctgcgctctacaacaagcttcgccttggtcaggttccc
gctgatgcccgcattattggtaccgcccgcacaacgctagaccgcgacgcttacattgcg
cgcgctcgcgatgcgctacagcacttcatcccagccaagtttttgttcccaaatcttctt
gagcaattcttgggaatgatcagctatgtcacgctggatggcacaagtgccgacagtaac
tggggcgaactcgccgccgaactcagcagttctccagcaagccgcatccgcgtattctac
ttcgcaacagcccctcagctgtacgaagccatctgcgcaaatctgcatgccaaagaaatt
ctgaccccagaatcgcgcgtcgtgctggaaaagccaatcgggacgagccttgaaacggct
gatgccatcaacgaaggcgtcggcaagttccttcccgaaaagcaaatctatcgcatcgac
cattatctgggcaaagaaaccgtccagaacgtactggctttgcgttttgccaaccccctc
ctcaacgcaatctggtctgctgagcacattaaaagcgtacagatcaccgcagcagaggtg
gtcggtgttgaagggcgcgcttcctactacgacacgtcaggcgcattgcgtgacatgatt
cagaaccaccttttacaggttctctgtcttgtcgccatggagcaacctgaaacgttggaa
gcagattgcgtccgtaacgcgaagctggccgttctcaaggctctgcgtccaatcaaagaa
gaccaagtcgcgaacgaaacggtacgcgcccaatatacgaagggtgcggttgatgaccat
gctgtgccaggatatctggaagagcttggccaagacagcaacacggaaacatacgctgcc
gtccgcacttgggtggataccccacgctggaaggatgtaccgttctacatccgcacagca
aagcgctccaagcgtaaggtcagcgaaattgtcattcaattccgcgaaaccgcgcagtcg
ctctttggtgcagttccgggcaatcggcttgttattcgcgtacagcctaacgaaggcgtt
gagctgaacctgaacgtcaagaaccctatccttgacgaataccagctcgaaaccgtgaag
cttgatgcgccaattaaagtcgagggcggcccattccccgactcatacgagcgcctcctg
ctggatgccgtccgtggcaaccccattctcttcatccgccgcgatgaagtggacgcagca
tgggtctgggctgaatccatcctcaatgcttgggccgataaaaaagcgcctatgcacagc
tacgcagcaggttcatacggtcctgacgcagctaaagcgctcctagctgaacacggggac
cgctggcatgaggatatggtgtga

DBGET integrated database retrieval system