KEGG   Nicotiana tomentosiformis: 104086785Help
Entry
104086785         CDS       T05025                                 

Definition
(RefSeq) long chain acyl-CoA synthetase 6, peroxisomal-like
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
nto  Nicotiana tomentosiformis
Pathway
nto00061  Fatty acid biosynthesis
nto00071  Fatty acid degradation
nto01100  Metabolic pathways
nto01212  Fatty acid metabolism
nto04146  Peroxisome
Module
nto_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:nto00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    104086785
   00071 Fatty acid degradation
    104086785
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    104086785
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nto01004]
    104086785
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nto04147]
    104086785
Enzymes [BR:nto01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     104086785
Lipid biosynthesis proteins [BR:nto01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   104086785
Exosome [BR:nto04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   104086785
  Exosomal proteins of breast cancer cells
   104086785
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 104086785
NCBI-ProteinID: XP_009589417
Position
Unknown
AA seq 562 aa AA seqDB search
MHQGARVGLYFINRPEWLIVDHACSAYSYTSVPLYDTLGPDAVKYIVNHADVQAIFCVPG
TLNTLLTFLSEIPSVRLIVVVGGIDEHLPSLPSTTGMKLLSYTRLLSQGRSSMQPFCPPK
PEDIATICYTSGTTGTPKGVVLSHANLIASVAGMTLSIKFYPSDIYISYLPLAHIYERAN
QITSVYYGVAVGFYQGDNLKLMDDLATLRPTIFSSVPRLYNRIYAGITNAVQTSGVLKQR
LFNAAYNSKKQAVMNGRKPSPMWDRLVFNKIKDKLGGRVRLMTSGASPLSPDVMEFLRVC
FGCLVMEGYGMTETSCVISSMDDSDILTGHVGSPNPACEIKLVDVPEMSYTSEDQPHPRG
EICVRGPIIFEGYYKDEVQTREVIDEDGWLHTGDIGLWLPGGRLKIIDRKKNIFKLAQGE
YIAPEKIENAYAKCKFVAQCFVYGDSFNSSLVAVVCVEPDVFKEWASSEGIKYESLGQLC
NDPRAKAAVLAEMDAVGREAQLRGFEFAKAVTLVIEPFTIENGLLTPTFKVKRPQAKAYF
AKAISDMYNELSTSDPASQKSL
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgcaccagggtgctcgcgtgggactttatttcataaataggcctgagtggctgattgta
gaccatgcctgctcagcgtattcatatacttcagtcccactatatgacactctaggtcct
gatgctgttaaatatattgtcaatcatgctgatgtacaggccattttttgtgtgcctggt
accttgaacacgttgttgacctttttatcagagattccttctgtacgtttgattgtggta
gtgggtgggatagatgaacatctcccatctcttccatctacaacgggaatgaagctctta
tcatatacaaggctgctgagtcagggccgcagcagtatgcaacccttttgccctcccaag
cctgaagatattgctaccatatgctatacaagtggtactacgggtacaccaaagggtgtc
gtactatcccatgcgaacctgatagcaagtgttgcgggcatgaccctttccatcaagttt
tatccttctgacatatacatatcctatctgcctctcgcgcatatctatgaacgtgccaac
caaattacatcggtatattatggtgttgctgttggcttctaccagggggacaatctgaaa
ttgatggatgatttggcgacacttagacctacaatatttagcagtgttcctcgtctttac
aacaggatatatgctgggatcacaaatgctgtacaaacttctggcgtactgaagcagaga
cttttcaatgctgcctacaactccaagaagcaagctgtcatgaatggtagaaagccatca
ccaatgtgggatagattggtattcaacaaaataaaggacaaactgggggggcgagttcgt
cttatgacctcaggtgcttcaccattgtcgcctgacgtgatggagttcttgagagtatgt
tttggctgtctagtaatggaagggtatggcatgactgaaacttcgtgtgtcataagctca
atggacgatagtgatatcttaactggtcatgttggttcaccaaatcctgcgtgtgagata
aagctcgtggatgttccggaaatgagttacacatcagaagatcagcctcatcctcgtgga
gagatttgtgttagaggtcctattatttttgaaggctattacaaagatgaagtgcagacg
agggaggtaattgatgaagacgggtggctgcatactggtgatattggattatggttacct
ggaggccgcttgaagattattgacaggaagaagaatatcttcaagttggcacaaggtgaa
tacatagctcctgagaaaattgagaatgcttatgccaaatgcaaatttgttgcacagtgt
tttgtctatggtgatagctttaattcctctttagtagcagtagtttgtgtagagccagat
gtctttaaggaatgggcatcatctgagggaatcaagtatgaaagtttgggacaactgtgt
aatgatccaagagcgaaggctgcagttcttgctgagatggatgctgttggaagggaagct
cagttgagaggtttcgaatttgcaaaagctgtaacattggttatcgagcctttcacgatc
gaaaatggtctgctcactcccactttcaaggtcaagagaccgcaggcaaaggcttatttc
gccaaagcaatatctgatatgtataatgagctttctacatcagatccagcatcccagaaa
tcactatga

DBGET integrated database retrieval system