KEGG   Nicotiana tomentosiformis: 104088031Help
Entry
104088031         CDS       T05025                                 

Definition
(RefSeq) uncharacterized protein LOC104088031
  KO
K17434  large subunit ribosomal protein L53
Organism
nto  Nicotiana tomentosiformis
Brite
KEGG Orthology (KO) [BR:nto00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:nto03011]
    104088031
Ribosome [BR:nto03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    104088031
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRP_L53 L51_S25_CI-B8
Motif
Other DBs
NCBI-GeneID: 104088031
NCBI-ProteinID: XP_009590931
Position
Unknown
AA seq 128 aa AA seqDB search
MLKFLSKVKIQFNALDPRTASCMEFLAQCNAPKAKESNPSCQVQVKRRTDDQPPEITVTF
VNGVEQTYDATSTPAQNIRTMILEKGQYLETEQMFREAGEKWPVIIPDEELQQPFLGIKP
KKAEEKKQ
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagttcttgtcgaaggtgaagatccagttcaatgccctagacccacgcacagct
tcatgtatggagtttttggctcagtgtaatgctcctaaagccaaagaatctaatccaagc
tgtcaagtacaggtcaagcgccgtacagatgaccaaccacctgaaatcactgtcacgttc
gtcaacggagtcgagcaaacctatgacgccacttctacacccgcacagaacatccgtact
atgattcttgagaagggtcagtatcttgagactgaacagatgtttcgtgaagctggtgag
aagtggcccgttattattcctgatgaagagctccaacaaccatttcttggtataaagcca
aagaaggccgaagagaagaagcagtga

DBGET integrated database retrieval system