KEGG   Nicotiana tomentosiformis: 104088880Help
Entry
104088880         CDS       T05025                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
nto  Nicotiana tomentosiformis
Pathway
nto00010  Glycolysis / Gluconeogenesis
nto00562  Inositol phosphate metabolism
nto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104088880
   00562 Inositol phosphate metabolism
    104088880
Enzymes [BR:nto01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     104088880
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     104088880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 104088880
NCBI-ProteinID: XP_009591923
Position
Unknown
AA seq 500 aa AA seqDB search
MLKNSMNVAQLLLLQVLLAIVIHISADESFDVRQHLSTVSRYGVVKDISDNSFVPSQITD
QCTPIHLNLVARHGTRAPTKKRIREFEALSARLEVLVRDAKEQKQSSDNIPAWLMGWSSP
WKGKRTGGELIHEGEDELYHLGIRVREQFPDLFSEEYHPDIYSIKATQVPRASASAVAFG
MGLFSGKGKLGTGAHRAFAVTSESRASDIVLRFHDCCQSYKDFRKSQKPTVEKLKEPILD
EITQALVRQYGLNFTKQDVSSLWFLCKQEASLLNITNQACSLFRPSEVSLLEWADDLESF
ILKGYGNSLNYRMGVPLLEDVIQSMEQAIKAKEEGYASGSYEKARLRFAHAETLLPFSCL
LGLFLEESEFELIQREETLQSPRKPPTKRNWRGSIVTPFAGNNMLVLYSCVSNNSSKYFV
KVLHNERPIPIPGCNGSDSCPFEVFKERIVAPHLKHDYNALCNVNLEQKEKNSAPSKLSQ
MFSWFFSLRNAVTPAQNVEL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagaactccatgaatgttgctcagctactactgcttcaagttctactcgcgatt
gtgatacacataagcgctgatgaatcctttgatgttcgtcaacatctatctactgtttcc
agatatggtgttgtgaaggatatatctgacaattcctttgtaccttcccaaattacagat
caatgtactcctattcatttgaatcttgtggcacggcatggcactcgtgctcctaccaag
aagaggataagggagtttgaagccttgtctgctcgactggaagtccttgtacgtgatgct
aaggaacagaagcagtcttcggataacattcctgcttggttaatgggatggagctctcct
tggaagggaaagcgtacgggtggagagttgatccatgaaggcgaagacgagttatatcat
cttggtatcagagtccgagaacagtttccagacctgtttagtgaagaataccaccctgat
atatattcaatcaaggctacccaggttcctcgggcatcagctagcgctgtggcattcggc
atggggctgtttagtggaaaagggaagcttggaaccggggctcatcgagcttttgctgtt
accagtgaaagccgtgcaagtgatatagttctgagatttcatgattgttgtcaaagctac
aaggattttaggaaaagtcagaagccaactgtagagaagctcaaagaacctatattagat
gaaattactcaagcactagtgaggcaatacgggcttaattttactaaacaggatgtatct
tccttatggtttctctgcaaacaggaagcttccctgttgaacatcaccaatcaagcttgt
agtctattcaggccatctgaggtttctttgttggaatgggccgatgatttggagtcgttc
atactgaagggctatggtaattcactaaattaccgaatgggagtcccgctacttgaggat
gtaattcaatccatggaacaggcaatcaaggctaaagaagaaggatatgcttccgggagc
tatgaaaaggcaagactacgttttgctcatgcagaaactctacttccgttttcatgcttg
cttgggctctttcttgaagaatctgaatttgaactaatacaaagagaggagacgttgcaa
tcccctcgtaagcctcctacaaagagaaactggcggggaagtatagtgacaccttttgct
ggaaataacatgcttgtcctttacagctgcgtgtcaaataactcaagcaagtactttgtg
aaagtgctgcacaatgaacgtccgattcctattccaggttgcaatggctcagattcttgc
ccatttgaagtatttaaggaaagaattgttgctcctcacttgaaacatgactacaacgcg
ctttgcaacgtaaacttggaacaaaaagagaagaattctgcccccagcaagttatcacaa
atgtttagttggtttttctccctgagaaatgctgttacacccgctcagaacgtggagcta
taa

DBGET integrated database retrieval system