KEGG   Nicotiana tomentosiformis: 104089132Help
Entry
104089132         CDS       T05025                                 

Definition
(RefSeq) probable protein S-acyltransferase 1
  KO
K16675  palmitoyltransferase ZDHHC9/14/18 [EC:2.3.1.225]
Organism
nto  Nicotiana tomentosiformis
Brite
Enzymes [BR:nto01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     104089132
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC HflK_N
Motif
Other DBs
NCBI-GeneID: 104089132
NCBI-ProteinID: XP_009592263
Position
Unknown
AA seq 417 aa AA seqDB search
MGSGITNQDLALSSKSMDPPKLKKRLYQVWKGRNKFLCGGRLIFGPDAASLYLSTFLIGT
PALTFCIKMLLMIPKVSPVYGHVVLIGGLIISVLALSFLFMTSSSNPGIVPRNSRPPDLD
EILNTSTASMEWVNNAAPDVKLPRTKDVFINGHSVKVKFCDTCLLYRPPRASHCSICNNC
VQRFDHHCPWVGQCIGVRNYRCFILFISTTTTLCIYVFTFSLLNLLGQPGSFLHVMSRDV
ISVILIVYCFIAVWFVGGLSVFHFYLMSTNQTTYENFRYRYEKKENPYSRGILKNLKEIL
CSKPSPSLVNFREWVIEEDDPSVKSVSMSHKFGSINSKGKFDLEMGGILGKDGTLQNMDY
SGIDDTLKKTTSDNANFDPLFFPDDQDTNDAESTHSNGLRTVEDDRTEQVSNLQGSS
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgggaagtgggatcacaaatcaagatttggctctttcttccaaatctatggaccctcct
aaattgaagaaaaggctttatcaagtttggaagggtcgcaataaatttctctgtgggggg
agattgatctttggtcctgacgcagcatcactttacttatcaacatttctgatagggact
cctgcattgacattttgcataaaaatgcttttgatgataccaaaagtgagtccagtatat
gggcatgttgtccttattgggggactcatcatctcagttttggccttgagttttctgttc
atgacatcttcaagcaatccaggaatagttcctaggaactcaagaccacccgacttggat
gaaatattaaatacaagtacggcatctatggagtgggtcaacaatgctgcccctgatgta
aagttaccgagaacaaaggatgtttttatcaacggtcattctgtcaaagtcaagttctgt
gacacatgtttgctatatcgtccaccacgtgcttcccattgctcaatttgcaacaactgc
gttcagagatttgatcaccactgtccgtgggtgggtcagtgtattggagttcgcaactat
cggtgctttatactgttcatatcaacaacaacaactttgtgcatatatgttttcacattt
tcgctgctgaacctccttggacaaccaggaagctttttgcatgtcatgtcaagggatgtc
atatctgtgattttgatcgtatattgcttcatcgctgtctggtttgtcggagggctaagc
gtcttccatttttacctaatgtcaaccaaccagacgacgtatgaaaacttcagatatcgt
tatgaaaagaaagagaacccatacagtcgtggcattttgaagaatctcaaggaaatttta
tgctctaagccctcaccttcattggtcaactttcgcgagtgggtgattgaagaagacgat
ccaagtgtgaaatccgtctccatgagtcataaatttggttcaatcaactctaaagggaag
tttgatttagagatggggggcatacttggaaaagacggtactttgcagaacatggattat
agtggcattgatgacactttgaagaagacgacaagtgataatgcaaattttgatcctctt
ttctttcctgatgatcaagatacgaatgatgcagagtcgacgcattcaaatggtctaaga
acagtggaagatgacagaactgagcaagttagcaacctgcagggatcttcatag

DBGET integrated database retrieval system