KEGG   Nicotiana tomentosiformis: 104091046Help
Entry
104091046         CDS       T05025                                 

Definition
(RefSeq) autophagy-related protein 16
  KO
K17890  autophagy-related protein 16-1
Organism
nto  Nicotiana tomentosiformis
Pathway
nto04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:nto00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    104091046
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nto04131]
    104091046
   03029 Mitochondrial biogenesis [BR:nto03029]
    104091046
Membrane trafficking [BR:nto04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    104091046
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    104091046
Mitochondrial biogenesis [BR:nto03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    104091046
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ATG16 ANAPC4_WD40 Nup160 Cytochrom_D1 eIF2A Ge1_WD40 DUF5046
Motif
Other DBs
NCBI-GeneID: 104091046
NCBI-ProteinID: XP_009594594
Position
Unknown
AA seq 509 aa AA seqDB search
MSYEEVAVGAIRDALKALRKRHLVEEGAHAPAFLALTRPLVLQGSEWKEKAENLEVELQQ
CYKAQARLSEQLVVEVAESRASKSLVQEKESIITDLQIELNQSRDECSRLTELLTEKTKA
LELLMGEHQDLKAQLEAMTLRANNAEAENKTLVDRWMLQKMQDAERLNEANALYEDMLDK
VKATSIEKLARQQVDGVVRQSEDGADFYAESSLPSICKQRIPAHDGGCAAILFEYNSSKL
ISSGQDRAIKMWDTTSGSLSNSLYGSLGSVLDLSITHDNKLIIAASSSNNLYVWDANSGR
IRHTLTGHIDKVCAVDVSKFSSRYVVSAAYDRTIKVWDLQKGYCTNTIIFHSNCNSLSFS
MDGLTICSGHVDGSLRLWDIQTGKLLSEVAAHSQAITSVSVSRNGNVILTSGRDNVHNLF
DIRTLEICGTFRANENRVASNWSRSCISPDDSYVAAGSVDGSVHIWSVSNARMVSTLKEH
TAPVLCCSWSGLGKPLATSDKSGIICIWS
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgtcatacgaagaagttgctgttggagcaattagggatgctttaaaggctctaagaaag
cggcatttagtggaggaaggggctcatgcccctgctttccttgccctcacgaggcctctc
gttttgcagggttcagagtggaaagagaaagctgaaaatcttgaagtggaacttcagcaa
tgttacaaagctcaagcacgactgtcggagcagcttgtggtggaagtagctgaatctaga
gcatcaaaatctttagttcaagagaaggaaagtatcattactgaccttcagatcgagcta
aaccaatcaagggatgaatgttctcgtttaactgaacttctcactgaaaagactaaagct
ttggagttgcttatgggtgagcaccaggaccttaaagcacaacttgaagcaatgactctg
agagcaaacaatgctgaggcagaaaataaaacgctggttgatcgctggatgctgcagaag
atgcaggatgcggagcgccttaacgaggctaatgctctctatgaagatatgctggataag
gtcaaggccaccagtatagagaaacttgctcgtcaacaagtagatggtgtggtccgccaa
agtgaagatggtgcagacttttatgcggagtcttcccttcctagtatatgcaagcaaaga
atccccgcccatgatggtggatgtgccgcgattctttttgagtacaactccagtaaattg
ataagcagtgggcaggacagggcaattaaaatgtgggatactacaagtggatcattaagc
aacagtctttatggttccctgggttctgtccttgatctttccattacacatgataacaaa
ctcatcatagcagcaagtagttcaaataacttgtatgtgtgggatgcaaattcaggcagg
atacgacatactcttactgggcatatagacaaagtttgtgctgtagatgtaagcaaattt
tcaagtcgctatgtggtgagtgctgcatatgatcgtaccataaaagtttgggatctgcag
aagggttactgtactaacactattatcttccacagtaactgtaacagcctttcgtttagc
atggatggcctgaccatttgttccggtcatgtagatgggagtcttagattatgggatatt
cagacagggaagcttctgagtgaagttgctgcacattcacaggctattacatcagtttca
gtctctcgaaatggaaatgtaatattaaccagcgggagagacaacgtgcacaatctcttt
gatattcgtacccttgaaatttgtggcactttcagagcgaatgagaaccgagttgcatct
aattggagtcgatcctgtatcagtccagatgatagttatgttgctgctggttctgttgat
ggatctgttcatatttggtcagtatcaaacgctagaatggtaagcactttgaaagaacac
acagcccctgttctatgttgttcatggagtggtcttggtaaacctctggctacctcggat
aagagtggaatcatatgtatttggtcatag

DBGET integrated database retrieval system