KEGG   Nicotiana tomentosiformis: 104095130Help
Entry
104095130         CDS       T05025                                 

Definition
(RefSeq) non-specific phospholipase C4-like
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
nto  Nicotiana tomentosiformis
Pathway
nto00562  Inositol phosphate metabolism
nto00564  Glycerophospholipid metabolism
nto00565  Ether lipid metabolism
nto01100  Metabolic pathways
nto01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    104095130
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    104095130
   00565 Ether lipid metabolism
    104095130
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:nto02042]
    104095130
Enzymes [BR:nto01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     104095130
Bacterial toxins [BR:nto02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   104095130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphoesterase Sulfatase
Motif
Other DBs
NCBI-GeneID: 104095130
NCBI-ProteinID: XP_009599478
Position
Unknown
AA seq 238 aa AA seqDB search
MSEAVMNGFKPEAVPVYKELVTEFAVCDRWFAAVPASTQPNRLFVHSGTSHGLTSNDTTK
LILGAPQKTIFESMDEAGYTFGIYYQYPPATLFYRNLRKLKYIKNFHQFDLHFKNHCKEG
KLRNYVVIEQRYFDLTILPRNDDHPSHDVFEGQKFVKQVYEALRSSPQWNEILFIIIYDE
HGGFFDHVPTPVTGVPSPDGINGLEPYKFQFNRLGVRVPAILISPWIERGTGTKFFNI
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaggcagtgatgaatgggttcaaaccagaggcggtgccggtttacaaagagctg
gtgacggaatttgctgtgtgtgaccggtggttcgcggcggttccggcgtctacacagcct
aataggttgtttgtgcactctggaacttctcatgggcttactagtaatgatacaacaaag
ttgattttaggggctcctcaaaaaactatatttgaatcaatggatgaagctggttacact
tttgggatttattatcagtaccctccagcaacactcttttacaggaatcttaggaaactg
aaatacataaagaacttccatcagttcgatcttcatttcaagaaccactgcaaagaggga
aagttacgaaattatgttgtaattgagcaaagatactttgacttaacaatcttgcctaga
aatgatgatcacccttctcatgatgtatttgaaggccaaaaatttgtgaaacaagtctac
gaggcattgagatcaagccctcaatggaatgaaatattgttcattataatatatgacgaa
catggtggtttctttgaccatgttccgactccggtcaccggcgttcctagccctgatgga
ataaatggtcttgaaccttataaatttcagtttaatcgcctaggtgttagggttccggcc
atcttgatttcaccgtggatcgaacgtggaacgggtactaagttcttcaatatataa

DBGET integrated database retrieval system