KEGG   Nicotiana tomentosiformis: 104095855Help
Entry
104095855         CDS       T05025                                 

Definition
(RefSeq) serine/threonine-protein kinase WNK8-like
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
nto  Nicotiana tomentosiformis
Brite
KEGG Orthology (KO) [BR:nto00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nto01001]
    104095855
   01009 Protein phosphatases and associated proteins [BR:nto01009]
    104095855
Enzymes [BR:nto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104095855
Protein kinases [BR:nto01001]
 Serine/threonine kinases: Other
  Wnk family
   104095855
Protein phosphatases and associated proteins [BR:nto01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104095855
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 104095855
NCBI-ProteinID: XP_009600371
Position
Unknown
AA seq 762 aa AA seqDB search
MPITLKIFPRAIGILLFRGIYPHANKLSSFSGQHLINTLFFCYFWVVLLWVVFVKSCYSF
VIIVWLITGMSFGGGSGCSYHSGNGHGFGNGSPLRRSSSNKGGSLGSAANDQQPNHQVDF
VEKDPKGRYVRYSEVLGKGAFKTVYKAFDLLDGIEVAWSRVKVDDVLQSPDNLGKLYAEI
HLLRQLKHDNIMKFCDSWIDDKKRTVNMITELFTSGNLRQYRKKYRSVNMKAIKNWARQI
LQGLDYLHCQSPPIIHRDLKCDNIFVNGNHGEIKIGDLGLATIMEQPTAKSVIGTPEFMA
PELYEEEYNELVDIYSFGMCMLELVTFEYPYSECKNPAQIFKKVSSGVKPASLGKVVDPQ
VKGFIEKCLVPAPQRLPAKDLLKDPFLQFENLNEPIHSLLQSPYQSPRSLSSLKSAPHSM
DVDSEYNQSVYTDSHCGSPCPPTLEFQRFHQNNEFKLTGKKNDENSVSLTLRIKCPSGRV
RNIHFNFYLDTDTALLVAAEMVDQLQLDDHDVDFIADFIDYLIMKILPSWKPPSEYRSSG
GRSHALENYLTLSPNPTTSNARQDDIPALGMNNQISTQADEDKLYANSNGTSCHVTFASP
SHLANVIDDESQGSVASQVMGKSSSLKNGNSFGFGDYFTDVVSKGSSGNLSEIDFTGLFH
DECKLQENGGDYVECILPNEFGKNLEVTLTDTDGGASKGMSLSSSCSFLSLIEKDEDTEL
KLELDTIEAQYQQCFQELSRMKQEALEACRKRWTMKKKLAGH
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcacgttgaagatttttccacgtgcgatcggcattctcttattccgaggcatt
tacccacatgcaaataagttgtcatctttttctgggcaacatttgattaatacgttgttt
ttctgctatttctgggttgtcctgctttgggttgtgtttgttaaatcttgttattccttt
gttataattgtttggttgattacgggaatgagtttcgggggtggatcaggatgttcttat
cattctggaaacggtcatggatttggaaatggaagcccgttacgacgttcttctagtaac
aaaggcggatctttaggttctgctgctaatgatcagcaacctaatcaccaagttgatttc
gttgagaaagatcccaagggtcgctatgttcggtacagtgaagtattgggcaagggagca
ttcaagactgtctacaaggcatttgacttgcttgatggtattgaagttgcatggagccga
gtgaaagtcgatgatgttttgcagtcaccagacaatttaggaaagttgtatgcggagatt
catcttcttcgacaattgaagcatgacaatataatgaagttctgcgattcgtggattgat
gacaagaagagaacagttaacatgataactgaactcttcacatctgggaacctgagacaa
taccgtaagaagtatagaagtgttaatatgaaggctataaagaattgggcacggcagata
cttcaagggttagactatcttcattgtcagagccctcctatcattcatagggacttgaaa
tgtgacaacatatttgtcaatggaaatcatggagaaattaagattggggaccttggattg
gcgaccattatggagcagcctactgctaagagtgtaattgggacgccggagttcatggcc
cccgagctttatgaagaagaatacaatgaactagtggacatatattcctttggaatgtgt
atgttggaattagtaaccttcgaatatccttacagtgaatgcaaaaatcctgctcaaatt
tttaagaaagttagctcgggtgttaaacctgcttccctcggcaaagttgtcgatccccaa
gtcaaaggattcattgaaaaatgcctggttcctgctcctcaaaggttgcctgccaaggac
cttcttaaagatccatttcttcaattcgagaatttaaatgagccaatccatagtcttttg
cagtcaccttaccaaagtccaagatcattaagttcattgaaatctgcacctcattctatg
gatgtagattctgagtataaccagtcagtatatacagactcccattgtggaagtccttgt
cctccaacattggaattccagaggtttcatcagaataatgaatttaaattgacgggtaag
aagaatgatgagaactcagtttcactgaccttgcgaattaaatgcccttcaggcagagta
cggaatatacacttcaatttctatcttgatactgacactgcacttttagttgcggctgag
atggttgatcaattgcaactagatgatcacgatgtagattttattgctgacttcattgac
tacctaataatgaaaattttgcctagttggaagcctccctctgagtaccgttctagtgga
gggagaagtcatgctcttgagaactacctaaccttgtcacccaaccctaccacatctaat
gctcgacaagatgatattccagctctgggtatgaataaccaaattagcactcaagctgat
gaagataaattgtatgctaactcaaatggcacttcttgtcatgttacttttgcttcccct
tcacatttggcaaatgtgatagacgacgagtctcaaggttcagttgcttctcaagtaatg
gggaaaagctcttctctaaagaatgggaattcatttggatttggcgattactttacagat
gttgtctctaaaggttctagtggaaacttatcggagatagatttcacgggtttgtttcat
gatgaatgtaagttgcaagaaaacggtggcgattatgtagaatgcatattaccaaatgaa
tttggaaagaatctggaggtaactttgacagatacagatggaggagcttccaaaggcatg
agtttgtcaagcagttgttcatttttatcgttaatagagaaagatgaggataccgagtta
aagttggagcttgacacaattgaagcacaatatcaacaatgctttcaggaactctcaaga
atgaagcaggaggcgttagaagcgtgcaggaagagatggacaatgaagaaaaagttggca
ggccattga

DBGET integrated database retrieval system