KEGG   Nicotiana tomentosiformis: 104095897Help
Entry
104095897         CDS       T05025                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein 2-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
nto  Nicotiana tomentosiformis
Pathway
nto03040  Spliceosome
nto04141  Protein processing in endoplasmic reticulum
nto04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:nto00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    104095897
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    104095897
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104095897
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nto01009]
    104095897
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:nto03041]
    104095897
   03009 Ribosome biogenesis [BR:nto03009]
    104095897
   03110 Chaperones and folding catalysts [BR:nto03110]
    104095897
   04131 Membrane trafficking [BR:nto04131]
    104095897
   03051 Proteasome [BR:nto03051]
    104095897
   03029 Mitochondrial biogenesis [BR:nto03029]
    104095897
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nto04147]
    104095897
Protein phosphatases and associated proteins [BR:nto01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     104095897
Spliceosome [BR:nto03041]
 Complex B
  Other components
   Prp19 complex
    104095897
 Complex C
   Prp19-CDC5 complex
    104095897
Ribosome biogenesis [BR:nto03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    104095897
Chaperones and folding catalysts [BR:nto03110]
 Heat shock proteins
  HSP70 / DNAK
   104095897
Membrane trafficking [BR:nto04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    104095897
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    104095897
Proteasome [BR:nto03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    104095897
Mitochondrial biogenesis [BR:nto03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    104095897
Exosome [BR:nto04147]
 Exosomal proteins
  Proteins found in most exosomes
   104095897
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C BcrAD_BadFG SNO DDR Hydantoinase_A DUF1464
Motif
Other DBs
NCBI-GeneID: 104095897
NCBI-ProteinID: XP_009600436
Position
Unknown
AA seq 639 aa AA seqDB search
MAGKGEGPAIGIDLGTTNCYVAVWKDDHVEMITEDCGGSELARMTPSYVSFVEDRRWIGL
SPKLGIENNPTNTVFDAKRLIGRRASDPSVQSDMKIWPFKVIAGPGDKPTICVDYKEEVK
QFTAEQISAMLLIELKRVAEKFVGSTVKNAVVSVPACFNDSQRQATKDACAIAGLNVMRV
INEPTAAGIAYFMDKKDSSTNVGKKNVLIFDLGGGTLDVSVLTIGDNIIEVKATAGDTHL
GGKDFDNKLVNHVVLQFKRKHRKDLTHSPKSLSQVWTTCEKMTRALSDNDEAIFDVYDLY
DGIPFGCNVSRAKFEELNTDLFKKCMEPVEKCLRDARMDKDSVDEIVLVGGSSRIPKIQQ
LLQDYFNGKELYKSINPEEAVAYGAAVQAAILSGEVSNEKIQDLLISDVTPLSIGLETTG
GVMTMLIPRDTTIPAKKERIFSTYSDNQTGLSIQVYEGERARTKDNNLLGKFELSGIHPI
PRGVPQITVSFNVDANGILNVSAEDKTTGQNKKITVTNDKGRLSKEEIEKMAKDEKQYKA
DDDKYRKRAEAEEALQGYTSFIHLWILGEENIVAQLSATDKKKVEDILEQANSWINTNPC
AETHELEDKKKEIEGLCNPIFVKIQPGPKEQEVWPKYVH
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atggccggaaaaggagaaggtccggcgatcggaatcgatctcggaaccacaaactgttac
gtcgccgtttggaaagatgatcatgtggagatgatcaccgaagattgcggtgggagtgag
ctcgctcgtatgacgccgtcctacgtttcttttgtagaagaccggcgttggattggtctc
agtcctaagcttggcatcgaaaataaccctactaacactgttttcgatgcaaagcgcctt
attggaaggagggctagtgatccctctgtacaaagtgacatgaaaatatggccatttaaa
gtaattgctggacctggtgacaagccaacgatttgtgtagactataaggaagaagtaaag
cagtttactgctgaacaaatctcagctatgttgcttatagagttgaagagagttgctgag
aaattcgttggatcaactgtcaaaaatgccgtggtgtctgtaccagcttgcttcaatgac
tcgcaacgtcaagctaccaaagatgcttgtgctattgctggtttgaatgttatgcgtgtt
atcaatgagccaacagctgcaggcattgcttattttatggacaaaaaagatagtagtact
aatgtaggaaagaagaatgtgcttatctttgatcttggtggtggtactcttgatgtttct
gttcttactattggagataatataattgaggtgaaagccacggcgggggacacgcatctt
ggaggaaaagatttcgacaataaattggttaatcacgtcgtcctgcaattcaagagaaag
cacaggaaggaccttacgcatagccctaaatcattaagccaagtatggacaacttgtgag
aagatgacgcgtgctctttccgacaatgacgaggcaatatttgacgtctacgacctatac
gatggaattcccttcggctgcaacgtctcgcgtgccaagtttgaggagttgaacacggac
ctctttaagaagtgtatggagccagttgagaaatgtttgagggatgcaagaatggacaag
gatagtgttgatgagattgtacttgttggtggatccagtagaattcccaaaatacaacag
ctattgcaggactactttaatggtaaggaactttacaagagtattaatcctgaggaagct
gttgcctatggtgctgctgtacaagctgcgattcttagcggagaggttagtaatgagaag
attcaagatttgctgatttcggatgtcacgcctctatcaataggattggaaacaacagga
ggagttatgactatgttaattccaagggacaccacaattcctgctaagaaagagaggata
ttttcaacatattcagataatcaaactggactgtcaattcaggtttacgaaggagaaaga
gcaagaacaaaagataacaacttgttgggcaaatttgagctctctggtatacaccctatt
cctagaggtgtacctcagataactgtttcctttaatgtcgatgccaatggaatattgaat
gtctctgctgaggacaagaccacgggtcagaacaaaaagattacagttacgaatgacaag
ggtaggctttcgaaggaagagattgaaaagatggcaaaggatgaaaagcagtacaaggca
gatgatgacaaatacaggaaaagagcagaagctgaagaagcattgcagggatatacctcc
ttcatacacttgtggatcttgggcgaggagaatattgtcgcgcagcttagcgcaacagac
aagaaaaaggttgaggatattcttgaacaggctaattcatggattaataccaatccatgt
gcagaaactcatgagttagaggacaagaagaaggaaattgaaggcttatgtaatcccatt
tttgtcaagatacagccagggccgaaagaacaagaggtatggcctaaatacgtacattaa

DBGET integrated database retrieval system