KEGG   Nicotiana tomentosiformis: 104097317Help
Entry
104097317         CDS       T05025                                 

Definition
(RefSeq) phosphatidylinositol-3-phosphatase myotubularin-1 isoform X1
  KO
K18081  myotubularin-related protein 1/2 [EC:3.1.3.64 3.1.3.95]
Organism
nto  Nicotiana tomentosiformis
Pathway
nto00562  Inositol phosphate metabolism
nto01100  Metabolic pathways
nto04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:nto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    104097317
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    104097317
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nto01009]
    104097317
Enzymes [BR:nto01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     104097317
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     104097317
Protein phosphatases and associated proteins [BR:nto01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    104097317
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related GRAM Y_phosphatase HAUS-augmin3 Y_phosphatase3 bPH_3
Motif
Other DBs
NCBI-GeneID: 104097317
NCBI-ProteinID: XP_009602169
Position
Unknown
AA seq 851 aa AA seqDB search
MYRSRSARSPNLREPDTRLAESDKIEGAGGWDALEWTKIDPVSRSVPIGVKQFLLEDEHV
VVEGYGVVLVNTDDAGTLFVTNFRLLFLSEGSRDIIALGTVPLATIEKVQKIVMKLPSGQ
RQPEKTGSQRLLQIIGKDMRIIVFGFRPRTKQRRAVYDALLRCARPARLWDLYAFAGGHS
RFSNTNPKVRLLNEYCRLLGMGFCQASIRAIEDGSFTLSNEYWRISSVNSNYTMSPTYPF
ALLLPKSISDDKVLQACTFRARCRLPAITWCDRGTGAVLARSSQPLVGLMMNMRSNADEN
LVAALCTQIAGEKRRKLYIADARPRKNALANGAMGGGSESSANYFQSEIVFFGIDNIHAM
RESLGRLRDYLDTHGTTSSDGMSSFLRHGGWSWGGGNLSSMSASVSTLGDTGWLIHVQTV
LAGSAWIAARVALESASVLVHCSDGWDRTTQLVSLASLLLDPYYRTIKGFQALVEKDWLA
FGHPFSDRLGMPTISGSGNMPFELSRQASTGSLPSSPVRQVSGSSSSQAQNTSHAQNQNS
PIFLQWVDCVSQLLRMYPFAFEFSSAFLVDLLDCMLSCRFGNFLCNSEKEREQAGISDAC
GCLWMYLAEVRASEGSSHAHYNLFYDPLKHDGPLLPPAAALAPTVWPQFHLRWACPSEAQ
GGEVEAECRKLTRKFSELQRAKEAAETRLNEISVTVESLVTELRNEKLVSTSAKDAVKRA
SKETATIKRAVQSLGFNVNFSPDGDCNVCIESNPTEIPQRSVCSVSTTNSNGSVHGSEKS
DLSEPVTVMQDDVSDNPLIQVCESLCPMHSRDSGCRWPNPGCAKFRSQFVGLKANFDAFD
RLPIYDNYFGT
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atgtatcggagtcggtcggcgcgatccccgaacctccgtgaaccggacactcgactcgct
gagtccgataaaattgaaggtgccggtggttgggacgcccttgaatggactaaaatcgat
cctgtttcgaggtcggttccaatcggagtgaaacaattcttgctggaggatgagcatgtt
gtagtagagggttatggggtagttcttgtcaacaccgatgatgctggaaccttatttgtg
actaattttcgcctccttttcttgagtgaagggtctagagatatcattgcacttggcacc
gtaccattggcgaccattgagaaggtccagaaaattgttatgaagcttccatcaggtcag
cgtcagcctgaaaagactggttcacagcgattgcttcagatcattggcaaagatatgaga
atcattgtctttggttttcgtcctcgaaccaagcagaggcgtgctgtctatgatgcatta
ttacggtgtgcaaggcctgcaaggttatgggatctctatgcatttgctggtggccattcc
aggtttagtaacacgaatcccaaagtaaggctgttgaatgagtactgccgacttcttgga
atggggttctgtcaagcttctatccgtgctattgaagatgggtcattcacactctcaaat
gagtattggagaataagcagtgttaactctaattacactatgtctccaacttatccattt
gctttactcttgccaaagtccataagtgatgacaaagtgctgcaggcttgtacattccgt
gcacggtgtaggctgccagccataacatggtgtgacagaggaactggggctgttcttgca
cgttcttctcaaccgctagttggcctcatgatgaatatgagaagcaatgcagatgagaat
ctagttgctgcactgtgtactcaaattgctggagagaaacggaggaagctatatattgct
gatgcaaggcccaggaaaaatgctttagcaaatggggcaatgggaggtggatcagagtca
tctgcaaactattttcagtctgagattgttttctttggcatcgataatatacatgcaatg
agggagagtcttggtcggcttagagactatttagatactcatggtactacttcatcagat
ggaatgtcatcttttctgaggcatggtggatggagttggggcggaggcaatctcagcagt
atgtctgcttcagtttctacactgggcgacactgggtggttaatacatgttcaaactgtc
ctggctggttctgcttggattgctgcacgtgttgcactagaatcagcttcagttcttgtt
cattgcagtgatggatgggatcgaactacgcaattggtctcacttgccagcttgctactt
gacccatactatcgtacaattaaaggatttcaggcacttgtagagaaagattggcttgca
tttggtcatccattttcagatcgtctgggaatgcccactatatctggaagtggcaacatg
ccgtttgaattatctcgccaggcttcgactgggagtttaccttcatcacccgtgcggcaa
gtatcagggtcatcctcatctcaagctcaaaatacatctcatgcacagaaccaaaattcc
cccattttcttgcagtgggttgattgtgtttcacagttgttaaggatgtacccttttgcc
ttcgagttctcttcggctttcctggtggatcttctggattgcatgctttcttgccgtttc
ggaaactttttgtgcaacagcgagaaggaaagagagcaagctggtatttctgatgcttgt
ggatgcctgtggatgtatttagctgaagtacgggcatcggaaggaagctctcatgcacat
tacaacctgttctatgacccgttgaaacatgatggtccgctactaccaccagcagcagct
ttagctccaactgtttggcctcagtttcaccttcgttgggcttgcccatcagaggcacaa
ggtggagaagtggaggcagaatgcaggaagttgactagaaaattctctgagctgcaaagg
gcaaaagaagcagcagaaacaagactgaatgaaataagtgtcacagtggagtccttagtt
acagaattgagaaatgagaaacttgtgagcacctctgccaaggatgcggtaaaaagagcc
agcaaagaaactgctactataaagcgtgcagtacaatctttgggttttaatgtcaacttt
tcaccagatggagactgtaatgtatgcattgaaagcaacccaacagaaattcctcagcgt
tctgtctgctcagtttctacaacaaattctaatggttcagtacatggcagtgagaaatca
gacctctctgaacctgttacagtgatgcaagatgatgtttccgacaatcctctcatccaa
gtttgtgaatcgttgtgccccatgcacagtagagacagtgggtgcaggtggccaaatcct
ggttgtgccaagtttcggagccaatttgttggtttgaaggccaactttgatgcatttgat
cgccttccgatatacgataattatttcggaacttaa

DBGET integrated database retrieval system