KEGG   Nicotiana tomentosiformis: 104100660Help
Entry
104100660         CDS       T05025                                 

Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit alpha-2, mitochondrial-like
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
nto  Nicotiana tomentosiformis
Pathway
nto00020  Citrate cycle (TCA cycle)
nto00640  Propanoate metabolism
nto01100  Metabolic pathways
nto01110  Biosynthesis of secondary metabolites
nto01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    104100660
   00640 Propanoate metabolism
    104100660
Enzymes [BR:nto01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     104100660
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     104100660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ligase_CoA Succ_CoA_lig
Motif
Other DBs
NCBI-GeneID: 104100660
NCBI-ProteinID: XP_009606229
Position
Unknown
AA seq 179 aa AA seqDB search
MSILSSFWSTLPLNQFDPDDLHSLLGSESANFFFACFMKSRSILLVFQTTAVGLGQSTCV
GIGGDPFNGTNFVDCLEKFIADPQTEGIVLIGEIGGTAEEDAAALIKESGTQKPVVAFIA
GLTAPPGRRMGHAGAIVSGGKGTSQDKIKALKEAGVTVCESPAKIGVTMLDAFKQRGLA
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgagtattctttcatctttctggagcacccttccccttaaccaatttgacccagatgat
ttgcattctctacttggatcagaaagtgctaatttcttcttcgcttgctttatgaagtca
agatcaattttattagtttttcagacaactgctgttggccttgggcagtcaacttgtgta
gggattggtggtgacccttttaatggtacaaattttgtcgattgcttagagaaatttatc
gctgatccacagacagaaggtatagttcttattggtgagatcggtggtacagcagaagaa
gatgctgcagccttgataaaggaaagtggaactcaaaagcctgttgttgcatttattgct
ggactaactgctcctcctggacggcgaatgggtcatgctggagccattgtatctggtgga
aagggaacatcgcaggacaaaatcaaggctctcaaggaagctggggttacagtatgtgag
tctcctgctaaaatcggggtcacaatgcttgatgcgttcaaacagaggggtcttgcataa

DBGET integrated database retrieval system