KEGG   Nicotiana tomentosiformis: 104101743Help
Entry
104101743         CDS       T05025                                 

Definition
(RefSeq) probable inactive receptor kinase At5g58300
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
nto  Nicotiana tomentosiformis
Brite
KEGG Orthology (KO) [BR:nto00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nto01001]
    104101743
Enzymes [BR:nto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104101743
Protein kinases [BR:nto01001]
 Serine/threonine kinases: TKL group
  IRAK family
   104101743
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr LRR_8 LRR_4 LRRNT_2 LRR_1 PRIMA1 Tweety CD34_antigen Astacin
Motif
Other DBs
NCBI-GeneID: 104101743
NCBI-ProteinID: XP_009607538
Position
Unknown
AA seq 690 aa AA seqDB search
MSCFLQEEPANCVSFSSKSLRRKARSEGLLQLKSCFSMFASQISKNIMKLQYLLAAVAFL
ISLLSNFPHVIADLDSDRQALLEFANSVPHIRKLNWNLTIPICKSWAGITCNKDGTRVIA
IHLPAVGLFGPIPANSIGKLDALKVLSLRANYLNGSLPSDLFSIPSLQSVYLQHNNFSGD
IPVSLSPRLGVLDLSFNSLTGKIPATIKSLSRLSVLNLQFNSLRGEIPSLDTLKLNHLNL
SYNMLNGSVPNSLQKFPLSSFVGNSRLCGTPLTSCSLNSPSPSPAADSLSPPERPKTVNS
KKLSTGTIIAIAVVASSLIFLLVLAISFCCLKKKVSDNTSTIKEKVALANGGRSEKTEDF
GSGVPDAEKNKLVFFEGCTYSFNLEDLLRASAEVLGKGSYGTAYKAVLDEATIVVVKRLR
EVGAAKKEFEQHMEIVGRVGRHPNIVPLRAYYYSKDEKLLVTEYMPAGSLSAALHGNSGI
GRTPLDWDTRLKISLGAAKGIAHIHTEGGVKFTHGNIKSSNILLTRDQDGCISDFGLTPL
MNYIPFKYRCAGYRAPEVIETRKGTQKSDVYSFGVLLLEMLTAKSPIPLSGHDEVVDLPR
WVRSVVREEWTAEVFDVELLKYQNIEEEMVQMLQIGLACVAKVPDMRPSMGEVVRMIEDI
RQPEGETRPSSEDNRSKDSNAQTPDLNLVI
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcttcctccaagaggaaccagctaattgtgtttcattctcctcaaagtcatta
cgcagaaaagcaagaagtgaagggctgctgcaactaaaatcttgctttagcatgtttgcg
agccagatcagtaaaaacataatgaagctccaatatttattggcagctgttgcttttctt
atttccttgctatcaaattttcctcatgttatagctgatcttgattccgatagacaggct
ctactcgagtttgcaaactctgttcctcatataagaaaactcaactggaatttgactatc
cctatctgcaaatcttgggctggtatcacttgcaacaaagatggaaccagagtcattgca
atccatctacctgctgttggactttttggtcctatcccggctaacagtataggaaagcta
gacgctcttaaagtccttagtttaagagccaattatcttaatggaagtcttccttctgat
ctcttttcaattccttccctccaatctgtctaccttcagcataataacttctctggtgat
attcctgtttctttatctcctcgacttggtgtactagatctatcgttcaactctttaact
ggaaaaattcccgccacgatcaagagcttgtcgcgattatctgtgttgaacctacagttc
aattcattgagaggagaaatccccagccttgacaccctcaagttaaaccacttgaatttg
agttacaacatgctaaatggctcagttccgaactccctccaaaagtttccactttcatca
ttcgtgggaaactctcgtttatgtgggacacctctaactagctgttctttgaattctcca
tcaccttctccagcagcagatagcttatctccacctgaaagaccaaagactgtcaactct
aagaaactaagtactggaaccatcattgccatcgcagttgtggcttcttcgttgattttt
ctcctagttttagctatctccttctgctgtttgaaaaagaaagtaagtgacaacactagc
acgattaaagaaaaagtggcactggctaatgggggaaggagcgagaagactgaggacttt
ggaagtggggtgccagatgctgagaagaacaagttggtattctttgaaggttgcacttac
agcttcaatctggaggatcttcttagagcttccgcagaggttcttggtaaagggagttac
ggaacagcttacaaagctgtcttggatgaggcgacgattgtggtggtgaaacggctgagg
gaagtaggtgctgctaaaaaagagtttgaacagcatatggagattgttggaagggttggg
aggcaccctaatattgtgccactccgtgcatattattattccaaggatgagaaacttctt
gttaccgaatacatgcctgctggtagcttgtcagccgccttacatggtaatagcggtatt
ggtagaactccactagactgggatacaagattgaagatatctctaggagcagcgaaagga
attgcccacatccacactgaaggtggagtgaaatttactcatgggaacatcaagtcctcc
aatatacttctcacaagagaccaagatggatgcatttctgattttggcttaacacctcta
atgaactacataccatttaagtatagatgtgctggttaccgcgctccagaagtgattgaa
acgcggaaagggacacaaaaatccgatgtttatagcttcggagtgttgctcctagaaatg
ctgacagccaaatcccctatcccattatcaggacatgatgaggtagttgacttgcctagg
tgggtgcggtcggttgttagagaggaatggactgctgaagttttcgacgtagagctgttg
aaataccagaatattgaagaagagatggtgcagatgcttcagattggacttgcttgtgta
gcaaaggtacctgatatgagacctagtatgggagaagtggttagaatgattgaagatatt
cgacaaccagaaggcgagacaaggccttcctctgaggacaacaggtctaaggattctaat
gcacaaacccctgatctgaacctagtaatttaa

DBGET integrated database retrieval system