KEGG   Nicotiana tomentosiformis: 104105479
Entry
104105479         CDS       T05025                                 

Definition
(RefSeq) delta(14)-sterol reductase isoform X1
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
nto  Nicotiana tomentosiformis
Pathway
nto00100  Steroid biosynthesis
nto01100  Metabolic pathways
nto01110  Biosynthesis of secondary metabolites
Module
nto_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:nto00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    104105479
Enzymes [BR:nto01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     104105479
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 OPA3
Other DBs
NCBI-GeneID: 104105479
NCBI-ProteinID: XP_009612086
Position
Unknown
AA seq 369 aa
MDLNYLFNSLFPSWTSAAMLLSFFLYLATVGSILPGKLVPGVILSDGTRLHYRCNGLLSL
LLLVLLLGVGAQMNLVSPTAIADRGFELLSTTFIFSVLVTLMLYLAGCNSREKSSSLKPH
VSGNLIDDWWFGIQLNPNFVGIDLKFFFVRAGMMGWLLINLSVLAKCIIEAKLSQSIILY
HLFCGLYILDYFLYEEFMTSTWDIIAERLGFMLVFGDLVFIPFTFSIQGWWLLSNKVELT
TAAVIANCLVFLIGYLVFRGANKQKHMFKKNPKAPIWGKPPKVIGGKLLASGYWGIARHC
NYLGDLLLALSFSLPCGISSAVPYFYPIYLLILLIWRERRDEARCAEKYKDVWTEYRKLV
PWRILPYVY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatctcaattatctcttcaactcccttttcccctcatggacttcggctgctatgtta
ctctcattctttctgtatttagcaactgttggatctatcctacccggaaaacttgttcct
ggtgtgattttatctgatggaactcgcctccattaccgttgcaatggtttgttatcactt
ttgttgttggttttgcttcttggagttggggcacagatgaatcttgtttcacctactgca
atagcagacagagggtttgagcttttgtccacaacatttatctttagtgttcttgtgaca
ttgatgctttatttggctggctgcaactcacgtgagaagagttcatcactgaaacctcat
gtctcaggaaatctaattgatgactggtggttcgggatacaactaaatcctaatttcgtt
ggcattgatctcaaatttttctttgttagagctggtatgatggggtggttacttatcaat
ctttcagttcttgcaaaatgtattatagaggccaaattgagccaatcaataattctctac
cacctattttgtgggctgtacatccttgattacttcctctatgaagagttcatgacctcc
acatgggatataatagcagagaggttgggcttcatgctggtttttggtgatctagtcttt
ataccgttcaccttcagtattcagggttggtggcttttgagtaacaaagttgagctaaca
acagcagcagtaattgccaattgcctcgtctttcttattgggtacttagtgttcagaggt
gccaataagcagaagcatatgtttaaaaagaatcccaaggcacccatatggggtaagcct
ccaaaagttattggggggaagttgcttgcttctggctattggggcattgctcgacactgt
aattaccttggagacttgttgctggcattgtcatttagtttgccttgtgggataagttcc
gcggttccatacttttaccccatataccttcttattctgctaatatggagggagagaagg
gatgaagctcgatgtgcagagaagtacaaagatgtgtggacagaataccgtaaacttgtt
ccttggaggatcttaccttatgtttactag

DBGET integrated database retrieval system