KEGG   Nicotiana tomentosiformis: 104107841Help
Entry
104107841         CDS       T05025                                 

Definition
(RefSeq) glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
nto  Nicotiana tomentosiformis
Pathway
nto00860  Porphyrin and chlorophyll metabolism
nto01100  Metabolic pathways
nto01110  Biosynthesis of secondary metabolites
Module
nto_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:nto00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    104107841
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nto01007]
    104107841
Enzymes [BR:nto01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     104107841
Amino acid related enzymes [BR:nto01007]
 Aminotransferase (transaminase)
  Class III
   104107841
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-GeneID: 104107841
NCBI-ProteinID: XP_009615049
Position
Unknown
AA seq 478 aa AA seqDB search
MAAVNGVGISWPSKLTQGQRPKLVFSPSPRRCTPSSSTIKMTASVDEKKKTFILQKSEEA
FSKAKELMPGGVNSPVRAFKSVGGQPIIIDSVKGSRMRDIDGNEYIDYVGSWGPAIIGHA
DDEVLAALAETMKKGTSFGAPCLLENTLAEMVISAVPSIEMVRFVNSGTEACMGVLRLAR
AFTGRPKIIKFEGCYHGHADPFLVKAGSGVATLGLPDSPGVPKAATSDTLTAPYNDISAV
ESLFEEHKGEVAAIILEPVVGNAGFIQPNLDFLAAIRKITKENDALLIFDEVMTGFRLAY
GGAQEYFGITPDLTTLGKIIGGGLPVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTA
GIHTLKRLQGPGTYEYLDKITGELTQGILDAGKKTGHAMCGGYIRGMFGFFFAEGPVNNF
SDAKKSDTEKFGRFYRGMLEEGVYFAPSQFEAGFTSLAHTSEDIQKTVAAAEKVLKQI
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgtaaatggtgtaggaatttcatggccatctaaattgactcaaggtcaaaga
cccaaattggttttctctccatctccccgccgatgcaccccatcttcttcaacaattaaa
atgacagcatcagttgatgaaaagaagaaaactttcattcttcaaaagtctgaagaagct
tttagcaaagccaaggagttgatgccaggaggtgtaaattccccagttcgtgctttcaag
tcagttggcggacaacctatcattattgactccgtgaagggctctcgtatgcgggacata
gatggtaacgagtacattgactatgtcggatcatggggtccagctataatcggtcatgca
gatgatgaggtgttagcagcattggctgaaacaatgaagaaaggaacgagttttggtgct
ccatgtctccttgaaaacactctggccgagatggttatttcagctgttccaagcatagaa
atggttcggttcgtcaactctggtacagaggcatgtatgggagtactacggctggctcgt
gctttcactggccggcctaagatcatcaaattcgagggttgttaccatggtcatgctgat
ccatttcttgttaaagcgggcagtggtgttgccaccctaggactccccgactcccctgga
gttccaaaagcagctacttctgatacactgacagcaccttacaacgatatttctgctgtt
gagagcctctttgaggagcacaaaggcgaagtcgctgctataattcttgagcctgtagtt
ggaaatgctggcttcattcaacctaatctagattttcttgctgccattcgcaagatcacc
aaagaaaatgacgcacttcttatttttgacgaagtcatgactggatttaggttggcatac
ggcggagctcaggagtattttggaataactccagatttgacgacacttgggaagattatc
ggcggtggcttgccagtaggtgcatacggaggaaggcgggatattatggagatggtagca
cctgcaggaccgatgtatcaagccgggaccctaagtggaaatccattggccatgactgct
ggaattcacacgcttaagcgattacagggaccgggtacatacgaatacttggacaagatc
accggtgaacttacacagggaatcttggatgctggaaagaagaccggtcatgcaatgtgt
ggcgggtacataagggggatgtttggcttctttttcgcggagggtcctgtcaataacttt
tcggatgcaaagaagagtgatacagaaaaatttggcagattctataggggaatgctggag
gaaggtgtatattttgcaccatcacagtttgaggctggatttactagcttagcacacact
tcagaggatattcaaaagacagtagctgcagctgaaaaagttctaaagcaaatttaa

DBGET integrated database retrieval system